BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0423 (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 26 1.0 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 26 1.0 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 26 1.0 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 26 1.0 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 2.3 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 21 2.5 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 24 4.1 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 24 4.1 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 24 4.1 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 24 4.1 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 4.1 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 4.1 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 9.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.5 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 9.5 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 9.5 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 9.5 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 9.5 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 26.2 bits (55), Expect = 1.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 429 EGEEKKDDKAIEPPMDPNV 485 E EE DD+ +E P++PNV Sbjct: 162 EDEEYDDDQYLEEPIEPNV 180 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 330 GTYEPNDDECLN---PWRDDTEE 389 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 330 GTYEPNDDECLN---PWRDDTEE 389 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 330 GTYEPNDDECLN---PWRDDTEE 389 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +3 Query: 591 KVQMHEDPISFTLEFYFAPNEYFTNTVLTKEY 686 ++Q H DP+ + F P YFT + Y Sbjct: 21 RIQGHSDPLGHSTPGSFDPQGYFTPPIANVGY 52 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 21.4 bits (43), Expect(2) = 2.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 2 VPSNVLVTTTHPKWS 46 VPSN L+ TTH ++ Sbjct: 1311 VPSNCLLDTTHETYN 1325 Score = 21.4 bits (43), Expect(2) = 2.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 149 SCRSDGVPTPECSSANPRLENSSKG 223 SC T EC+S + + SS+G Sbjct: 1330 SCERIAGETFECTSTSSKFSTSSRG 1354 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 32 FTFSFYTPALDYYLNHPIRKYIILKDLPD 60 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 32 FTFSFYTPALDYYLNHPIRKYIILKDLPD 60 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 621 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 707 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 4.1 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 137 H*SPSCRSDGVPTPECSSANPRLENSSKGVCRH*GQVLQ*STCTRM 274 H S S S VPT +S PR SS R+ Q+ + +M Sbjct: 49 HSSTSASSSSVPTLPTTSGEPRAAGSSSNSRRNSKQLQRDELAAKM 94 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 4.1 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 137 H*SPSCRSDGVPTPECSSANPRLENSSKGVCRH*GQVLQ*STCTRM 274 H S S S VPT +S PR SS R+ Q+ + +M Sbjct: 49 HSSTSASSSSVPTLPTTSGEPRAAGSSSNSRRNSKQLQRDELAAKM 94 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -1 Query: 497 WDTLYIGIHWRLNSLVILLFLTLSDGSILYRP 402 WDT Y + W +++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 126 IAAITNRLHAEAMASLPPNVRRRIRALRTLQKEF 227 + A++NR + A A + +R LRT KEF Sbjct: 64 LPALSNRHNDNATAEYLSCYYQNVRGLRTKTKEF 97 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 165 ASLPPNVRRRIRALRTLQKE 224 AS+PPN+ IR + LQ E Sbjct: 762 ASIPPNLEEAIRGPQGLQGE 781 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -1 Query: 497 WDTLYIGIHWRLNSLVILLFLTLSDGSILYRP 402 WDT Y + W +++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -1 Query: 497 WDTLYIGIHWRLNSLVILLFLTLSDGSILYRP 402 WDT Y + W +++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -1 Query: 497 WDTLYIGIHWRLNSLVILLFLTLSDGSILYRP 402 WDT Y + W +++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,893 Number of Sequences: 2352 Number of extensions: 13337 Number of successful extensions: 74 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -