BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0420 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38640.1 68417.m05469 choline transporter-related contains we... 28 6.1 At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 27 8.1 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 27 8.1 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 27 8.1 >At4g38640.1 68417.m05469 choline transporter-related contains weak similarity to CD92 protein [Homo sapiens] gi|16945323|emb|CAC82175 Length = 556 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 273 NYANYNFAGFTFITRCYS--FTVEVNREHLLSTYFIRKIGTRL 395 N NFA T C S T E+ R +LLS F+ + TR+ Sbjct: 413 NKFTINFAAITGEAYCTSAKMTYELLRRNLLSAVFVETVSTRI 455 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 214 EIGGAVVPTRADSQEVLPPVITQI 285 ++ GA+V R + QE LPP++T + Sbjct: 88 QVIGAIVDVRFEDQEGLPPIMTSL 111 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 214 EIGGAVVPTRADSQEVLPPVITQI 285 ++ GA+V R + QE LPP++T + Sbjct: 91 QVIGAIVDVRFEDQEGLPPIMTSL 114 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 214 EIGGAVVPTRADSQEVLPPVITQI 285 ++ GA+V R + QE LPP++T + Sbjct: 88 QVIGAIVDVRFEDQEGLPPIMTSL 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,714,906 Number of Sequences: 28952 Number of extensions: 290431 Number of successful extensions: 562 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -