Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0417
         (657 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetyla...    22   5.1  
EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetyla...    22   5.1  
AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    21   8.9  

>EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetylase
           2B protein.
          Length = 528

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 588 LHFYLSWLKDQ 620
           LHF+ SWLK +
Sbjct: 414 LHFHASWLKSK 424


>EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetylase
           2A protein.
          Length = 535

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 588 LHFYLSWLKDQ 620
           LHF+ SWLK +
Sbjct: 421 LHFHASWLKSK 431


>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -1

Query: 123 LTNIFLANISHFGQIYYRLNVIKLRKASISVFF 25
           LTN+   N +   + YY LNV  L  + +++FF
Sbjct: 43  LTNLTYNNTN---RKYYWLNVCCLNLSIVTIFF 72


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,152
Number of Sequences: 336
Number of extensions: 3131
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16969115
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)