BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-0417
(657 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 5.1
EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 5.1
AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 8.9
>EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase
2B protein.
Length = 528
Score = 21.8 bits (44), Expect = 5.1
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = +3
Query: 588 LHFYLSWLKDQ 620
LHF+ SWLK +
Sbjct: 414 LHFHASWLKSK 424
>EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase
2A protein.
Length = 535
Score = 21.8 bits (44), Expect = 5.1
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = +3
Query: 588 LHFYLSWLKDQ 620
LHF+ SWLK +
Sbjct: 421 LHFHASWLKSK 431
>AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor
candidate 23 protein.
Length = 291
Score = 21.0 bits (42), Expect = 8.9
Identities = 12/33 (36%), Positives = 19/33 (57%)
Frame = -1
Query: 123 LTNIFLANISHFGQIYYRLNVIKLRKASISVFF 25
LTN+ N + + YY LNV L + +++FF
Sbjct: 43 LTNLTYNNTN---RKYYWLNVCCLNLSIVTIFF 72
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,152
Number of Sequences: 336
Number of extensions: 3131
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16969115
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -