BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0417 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 27 0.69 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.8 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 4.9 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 24 4.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 6.4 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 8.5 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 26.6 bits (56), Expect = 0.69 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = -3 Query: 214 LSLAYLTCPDL*DAGGRNHVDFYRHLALELTD*HFPR*H*PFWPNILSIKCYKTEKSFNI 35 L + C +L AGG + + + TD P+ H PF+ + +++C E S Sbjct: 798 LEAGNVVCRELGFAGGAIEIKSHSYFPPNGTDPDEPKQHGPFF-MMDAVRCQGNESSLRE 856 Query: 34 CVF 26 C F Sbjct: 857 CSF 859 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 464 QRISSHEISSPSIYLQKECHQ*AQECIEWC 375 ++ S HE+ ECH+ EC E C Sbjct: 447 KKSSDHEVMVQKNRNATECHEEGMECSEQC 476 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 4.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 501 RFSKFRKGCQTLPENFV 451 +F + R+GC TLP V Sbjct: 401 QFVRIRRGCNTLPNEMV 417 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +3 Query: 306 CLTRIPMPVPKSFSTS*RISARTTPFNTFLCSLMTFFLKI 425 C + +P+ F+T R+ T T C++ F K+ Sbjct: 31 CRAELGGELPEDFATKMRLGDLTLDSETAKCTIQCMFAKV 70 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.4 bits (48), Expect = 6.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 503 QDEFVQHMTARIIAKLACWHPQP 571 QDE + + ++I+ + CWHP P Sbjct: 520 QDEDILVVLSKIMQE--CWHPSP 540 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 588 LHFYLSWLKDQLKTNNNDYI 647 + FYL K+ LK + DYI Sbjct: 369 IQFYLYGFKESLKATHPDYI 388 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,404 Number of Sequences: 2352 Number of extensions: 13304 Number of successful extensions: 55 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -