BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0415 (680 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q54HF4 Cluster: Putative uncharacterized protein; n=2; ... 34 3.7 UniRef50_Q54PE2 Cluster: Putative uncharacterized protein; n=1; ... 33 6.4 >UniRef50_Q54HF4 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1677 Score = 33.9 bits (74), Expect = 3.7 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = -3 Query: 597 ISTDQLLRKSYLHLTYKRSLTLLFLA*SRHNHSNLNLR 484 I ++ L RKS ++L Y+++LTL+ L H++ N+ LR Sbjct: 807 IPSENLSRKSSVNLIYQKTLTLMALIEFNHHYQNIELR 844 >UniRef50_Q54PE2 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 484 Score = 33.1 bits (72), Expect = 6.4 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -2 Query: 514 PT*SLQPESATTNLKKKKQHPL*RIKINNARLTSQTPSTNNYNNVNIIG 368 PT P S+ TNL PL + +NN + + NN NN N IG Sbjct: 354 PTFDFSPSSSPTNLYPSSSSPLFNLNLNNLNNLNNLNNNNNSNN-NSIG 401 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,893,823 Number of Sequences: 1657284 Number of extensions: 9778434 Number of successful extensions: 20758 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20696 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52892566912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -