BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0413 (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81030-14|CAJ43441.1| 75|Caenorhabditis elegans Hypothetical p... 28 6.7 AF068713-3|AAC17793.1| 286|Caenorhabditis elegans Serpentine re... 28 6.7 >Z81030-14|CAJ43441.1| 75|Caenorhabditis elegans Hypothetical protein C01G10.17 protein. Length = 75 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 602 NRQTNNSGHLRWYTITASNRQ*YLYRNGGAG 510 N NN+G+ +Y +N Y Y NG +G Sbjct: 29 NNYNNNNGYTTYYYYPNNNNNGYYYNNGCSG 59 >AF068713-3|AAC17793.1| 286|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 66 protein. Length = 286 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 115 MTWHSEC*SVIR*SFLIDLTYTV*NPRNKVF 207 +TW SE S+I F ID+ YT P NK++ Sbjct: 36 ITWKSEF-SLIYTRFAIDIVYTFFVPHNKIY 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,592,631 Number of Sequences: 27780 Number of extensions: 290344 Number of successful extensions: 549 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -