BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0410 (632 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 4.6 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 8.1 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 8.1 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 8.1 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 8.1 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 8.1 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 8.1 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 4.6 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +3 Query: 12 EKRKKNIAVLSSFIILI---YLMLLDSFKVVKSIYF*VAFIYLGIFIRRYSIVGL*VHVA 182 E + +A + SF I ++ L+D++ V +S + LG+ + Y +G+ + Sbjct: 238 ESSEGELAAMVSFAIAFPDGFMALVDTYDVKRSGLLNFCAVALGLNDQGYRAIGIRIDSG 297 Query: 183 RYIYLS 200 YLS Sbjct: 298 DLAYLS 303 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 529 ILNSLGVFLFTFLSRYIFKFYVLLLNKAVCTY 624 IL +G+F + F +Y FK ++ N AV ++ Sbjct: 157 ILTGVGLFYYWFHIKYFFK---IMKNSAVLSF 185 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 529 ILNSLGVFLFTFLSRYIFKFYVLLLNKAVCTY 624 IL +G+F + F +Y FK ++ N AV ++ Sbjct: 157 ILTGVGLFYYWFHIKYFFK---IMKNSAVLSF 185 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 529 ILNSLGVFLFTFLSRYIFKFYVLLLNKAVCTY 624 IL +G+F + F +Y FK ++ N AV ++ Sbjct: 157 ILTGVGLFYYWFHIKYFFK---IMKNSAVLSF 185 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 529 ILNSLGVFLFTFLSRYIFKFYVLLLNKAVCTY 624 IL +G+F + F +Y FK ++ N AV ++ Sbjct: 157 ILTGVGLFYYWFHIKYFFK---IMKNSAVLSF 185 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 529 ILNSLGVFLFTFLSRYIFKFYVLLLNKAVCTY 624 IL +G+F + F +Y FK ++ N AV ++ Sbjct: 157 ILTGVGLFYYWFHIKYFFK---IMKNSAVLSF 185 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 529 ILNSLGVFLFTFLSRYIFKFYVLLLNKAVCTY 624 IL +G+F + F +Y FK ++ N AV ++ Sbjct: 384 ILTGVGLFYYWFHIKYFFK---IMKNSAVLSF 412 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,441 Number of Sequences: 2352 Number of extensions: 10986 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -