BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0405 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66070.1 68414.m07499 translation initiation factor-related s... 42 3e-04 At5g37475.1 68418.m04510 translation initiation factor-related s... 33 0.13 At1g61840.1 68414.m06978 DC1 domain-containing protein similar t... 30 1.6 At4g26120.1 68417.m03760 ankyrin repeat family protein / BTB/POZ... 29 2.9 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 28 5.0 At3g44300.1 68416.m04757 nitrilase 2 (NIT2) identical to SP|P329... 28 5.0 At3g50590.1 68416.m05533 transducin family protein / WD-40 repea... 28 6.6 At3g47440.1 68416.m05158 major intrinsic family protein / MIP fa... 27 8.8 At3g44320.1 68416.m04760 nitrilase 3 (NIT3) identical to SP|P460... 27 8.8 At1g76770.1 68414.m08934 heat shock protein-related contains sim... 27 8.8 >At1g66070.1 68414.m07499 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 226 Score = 42.3 bits (95), Expect = 3e-04 Identities = 23/54 (42%), Positives = 32/54 (59%) Frame = +3 Query: 522 KTAEEMTPEQKLAEKLRQQKLQEESDLRLAMETFGVTEGNIGKLDNFHPTTKEE 683 K A + P +AEKLRQQ+L EE+D R E FGV + + LD F P ++ + Sbjct: 76 KEAPKEKPLDPIAEKLRQQRLVEEADYRATAELFGVKDDD-KNLDMFIPKSESD 128 >At5g37475.1 68418.m04510 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 225 Score = 33.5 bits (73), Expect = 0.13 Identities = 28/118 (23%), Positives = 46/118 (38%), Gaps = 1/118 (0%) Frame = +3 Query: 279 WDADNFEPKLPTTLAASNKWEGEDEDD-NVXXXXXXXXXXXXXXXXXXAAXXXXXXXXXX 455 W+A++F+P LP+ + + W+ ED D+ ++ A+ Sbjct: 4 WEAEDFQP-LPSKVELKSNWDDEDVDENDIKDSWEEEDVSAPPPIVKPASEKAPKKPAVK 62 Query: 456 IHDKIXXXXXXXXXXXXXLVTEKTAEEMTPEQKLAEKLRQQKLQEESDLRLAMETFGV 629 +K + K P +AEKLR Q+L EE+D + E FGV Sbjct: 63 AVEK----------KVKTVEAPKGTSREEPLDPIAEKLRMQRLVEEADYQSTAELFGV 110 >At1g61840.1 68414.m06978 DC1 domain-containing protein similar to hypothetical protein GI:3184279 from [Arabidopsis thaliana]; contains Pfam profile PF03107: DC1 domain Length = 814 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 176 SDKSLSIVVRFWCSGEKFSY*FGC*FWSPKN 268 SD+ LS++ FWC+ ++F+ GC S N Sbjct: 278 SDEDLSVLPLFWCNNKEFNVDGGCDICSGSN 308 >At4g26120.1 68417.m03760 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 600 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +3 Query: 525 TAEEMTPEQKLAEKLRQQKLQEESDLRLAMETFGVTEGNIGKLDNFHPTT 674 + EE TPE++L +K R +LQE M+TF + GK PT+ Sbjct: 527 SVEEDTPEKRLQKKQRYMELQE-----TLMKTFSEDKEECGKSSTPKPTS 571 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 515 DREDCRRNDSRAEVG*ETSPAEATGRIRFATSHGNLWC 628 +RE+ N+S+ E SP EA IR +H NL+C Sbjct: 28 EREENNNNESQEETRTSRSPNEALDEIRRQQTH-NLYC 64 >At3g44300.1 68416.m04757 nitrilase 2 (NIT2) identical to SP|P32962 Nitrilase 2 (EC 3.5.5.1) {Arabidopsis thaliana} Length = 339 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 356 ILVFPFPFVGGCQRGREFGLEV 291 ++VFP F+GG RG FGL V Sbjct: 53 LVVFPEAFIGGYPRGFRFGLGV 74 >At3g50590.1 68416.m05533 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); some similarity to s-tomosyn isoform (GI:4689231)[Rattus norvegicus]; contains non-consensus AT-AC splice sites at intron 18 Length = 1606 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 237 NSAADSGVLKMDVSWDADNFEPKLPTTLAASNKWE 341 N AA+S V K W N+E K PT + + KWE Sbjct: 991 NFAAESMVPK-GPEWGGGNWEIKTPTDMKSIPKWE 1024 >At3g47440.1 68416.m05158 major intrinsic family protein / MIP family protein contains Pfam profile: MIP PF00230 Length = 256 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -1 Query: 682 SSFVVGWKLSSLPMLPSVTPKVSMASRKSDSSCSFCWRSFSANFCSGVISSAVFSVT 512 SS + W +S + P+VT +++A R S + F W S + V++ V VT Sbjct: 73 SSVYISWNVSGGHVNPAVTFAMAVAGRISVPTAMFYWTS---QMIASVMACLVLKVT 126 >At3g44320.1 68416.m04760 nitrilase 3 (NIT3) identical to SP|P46010 Nitrilase 3 (EC 3.5.5.1) {Arabidopsis thaliana} Length = 346 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 356 ILVFPFPFVGGCQRGREFGLEV 291 +++FP F+GG RG FGL V Sbjct: 60 LVLFPEAFIGGYPRGFRFGLAV 81 >At1g76770.1 68414.m08934 heat shock protein-related contains similarity to 17.9 kDa heat-shock protein [Helianthus annuus] gi|11990130|emb|CAB55634 Length = 244 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +3 Query: 510 LVTEKTAEEMTPEQKLAEKLRQQKLQEESD 599 +V EKT E+ PE+++ E+ + ++ EE++ Sbjct: 150 IVEEKTEEKTEPEEEIKEETKPEEENEEAE 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,855,991 Number of Sequences: 28952 Number of extensions: 229833 Number of successful extensions: 684 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -