BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0400 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 2.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 5.5 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 5.5 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 7.3 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 9.7 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.0 bits (52), Expect = 2.4 Identities = 19/71 (26%), Positives = 26/71 (36%) Frame = -3 Query: 237 TPVTVSGTPWAVSTYSHIGFNVITSRDIRWTSVTRHQAHAHPPTMVRFVVGPKQPPETIS 58 T T + P +T+S + T+ W T PPT + P PP T + Sbjct: 193 TATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPPTTTTWSDLPPPPPTTTT 252 Query: 57 ASLGPTVWMLP 25 TVW P Sbjct: 253 T----TVWTDP 259 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 84 PKQPPETISASLGPTVWMLPILNPFTVT 1 P QPPET++ + + + P + P T T Sbjct: 1471 PVQPPETLTPAGSVAITVEPSVPPATTT 1498 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 450 PTSGAATSRTKPANWSLSLYTSSTVRVPRIAR 355 P + + T+P +W S TS R+PR R Sbjct: 274 PPARRRSRSTRPTSWPRSRPTSKPKRLPRRRR 305 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 7.3 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +1 Query: 295 PGQDRQRD*DDCPANVGGSFASYSRNSYSRRGVQRQGPIRGLG 423 PGQ +GG A+ R+S + G RQ GLG Sbjct: 1154 PGQQPSPGSRSYNGQMGGGGANRKRSSATNNGGGRQSSNNGLG 1196 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +2 Query: 224 TVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 346 ++ G+A CK + + + L K + K + QT E Sbjct: 10 SIHGIASCKRHRDPNAIQRVAREGLAKGISIKKCDIFQTCE 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 827,241 Number of Sequences: 2352 Number of extensions: 20270 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -