BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0396 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 4.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.2 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 8.2 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -1 Query: 355 VDRSNTTLALCTGPNCEKYSRSCRWPTVQAR 263 V NT CT + EKY C V+ + Sbjct: 182 VSMENTENKSCTDSDIEKYKMFCNLENVKLK 212 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 8.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 559 QSPLDSLFNKAADHLRKVTNKLNNGQLLGVVPGCSSKVLK 678 QSP + L KV N+GQL+ V + K LK Sbjct: 1100 QSPHQQQQQQQQKILAKVLTSSNSGQLISVENLLAQKGLK 1139 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 189 LHLLEIVSL*VMASTARAARLYVGNLAWTVGHRQLREYFSQFGP 320 +HL EI + A LY+G L+ + R+ RE+ + P Sbjct: 109 IHLKEIEDTEPILLIAYIYHLYMGLLSGGIILRKKREFMQKIWP 152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,000 Number of Sequences: 438 Number of extensions: 3539 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -