BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0394 (564 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1221 + 9873399-9873869,9873969-9874033,9874226-9874655,987... 28 4.5 03_05_0124 + 21034963-21035181,21035618-21037466,21037485-210381... 27 7.8 >01_01_1221 + 9873399-9873869,9873969-9874033,9874226-9874655, 9874656-9874754,9874977-9875240 Length = 442 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 16 LSLQIGPLPEIPGYTRYGCRFVVRGTYRHRHVG*WEFPLKFQQLR 150 L+L +G L + YT + +F+ TY +G W + F+ L+ Sbjct: 190 LALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIFRHLK 234 >03_05_0124 + 21034963-21035181,21035618-21037466,21037485-21038194, 21038426-21038470,21038557-21038745 Length = 1003 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 326 KIFQVYNSFDSNTFIFVYSFGCLPRCDQNMFSY 228 +IFQV NS D N F F RC +FS+ Sbjct: 521 RIFQVVNSMDDNRRYFSSFFKNNRRCFSKLFSH 553 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,066,117 Number of Sequences: 37544 Number of extensions: 245457 Number of successful extensions: 431 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -