BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0393 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 25 0.89 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 23 3.6 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 4.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 6.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.3 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 24.6 bits (51), Expect = 0.89 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 73 ETVCYIVPKLLLFQYPFVT 129 +TVC+++P +LLF FV+ Sbjct: 225 KTVCFVIPIMLLFLAFFVS 243 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 201 RCVDDNNELHITKEIIFSARKAVTCDK 121 RCV D + HIT+ +I +A T ++ Sbjct: 119 RCVIDYVKFHITQYMISNANSNTTSEE 145 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 520 HAGYLILHQSSMWPEKLFIYLFVY 591 H GYLI + + LF+ +F Y Sbjct: 203 HLGYLIFSSTISFYLPLFVMVFTY 226 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 224 IRPGGVRNYLT 256 I P G+RNYLT Sbjct: 331 ILPDGIRNYLT 341 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 95 LNYYFSSIPLSHVTAFRALNIISFVMCNSL 184 LNY+ + L+H N F++ NSL Sbjct: 219 LNYFTEDVGLNHFYFMLNHNYPPFMLSNSL 248 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 95 LNYYFSSIPLSHVTAFRALNIISFVMCNSL 184 LNY+ + L+H N F++ NSL Sbjct: 219 LNYFTEDVGLNHFYFMLNHNYPPFMLSNSL 248 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,706 Number of Sequences: 438 Number of extensions: 3998 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -