BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0386 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.0 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 1.8 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 23 3.2 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 3.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 5.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 7.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.3 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 21 7.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.3 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 633 NISALLILYFFFFDGCSGLIESTSSPTVASVLVPV 529 NISA I Y F C +I+S S ++ VPV Sbjct: 138 NISATYICYAFGKFSCKVMIQSVSFAFPINLSVPV 172 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 633 NISALLILYFFFFDGCSGLIESTSSPTVASVLVPV 529 NISA I Y F C +I+S S ++ VPV Sbjct: 371 NISATYICYAFGKFSCKVMIQSVSFAFPINLSVPV 405 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 633 NISALLILYFFFFDGCSGLIESTSSPTVASVLVPV 529 NISA I Y F C +I+S S ++ VPV Sbjct: 371 NISATYICYAFGKFSCKVMIQSVSFAFPINLSVPV 405 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 295 NKVSFH-ILLTIYYYN*WVICNIYIL*DLFCC 203 NK+ H +LLTI Y W I +Y L L+ C Sbjct: 229 NKLYGHQLLLTILTYLIWTIYEMYHLAILWSC 260 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 207 VVESVVKVSPNFTTPQSSISAGKL 136 V+E KV PNF T + GKL Sbjct: 98 VIEKPRKVLPNFKTDEPICPDGKL 121 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +2 Query: 305 KFEETKYEVFSPEELWKQFLHVRLNTVLPLRCEATISGVKNSLQNKRK 448 +FE++K+E F + L N L + C+ S ++N +K Sbjct: 226 RFEKSKFEPFLISNISLVSLIFLFNCTLIIMCDCVRSEASKVVKNAQK 273 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 158 LCGVVKFGETL 190 LC VVK+G+TL Sbjct: 112 LCKVVKYGQTL 122 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 287 VPYHMSPYGHP 297 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 287 VPYHMSPYGHP 297 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 287 VPYHMSPYGHP 297 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 243 VPYHMSPYGHP 253 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 287 VPYHMSPYGHP 297 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 75 VPYHMSPYGHP 85 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 60 VPSYISPYKHP 28 VP ++SPY HP Sbjct: 287 VPYHMSPYGHP 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,002 Number of Sequences: 336 Number of extensions: 3527 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -