BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0386 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0460 + 19360075-19360320,19361189-19361368 32 0.38 12_01_0016 + 125052-127145 29 3.5 >12_02_0460 + 19360075-19360320,19361189-19361368 Length = 141 Score = 32.3 bits (70), Expect = 0.38 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +2 Query: 410 ISGVKNSLQNKRKKIASGQVSFHIDSTQVYLFGVASDVGLTGTSTEATVGELVDSMSPE 586 +S + N L+ K IASG+ + T ++L +A DVG+T + LV++ +PE Sbjct: 52 VSFIANKLETIWKGIASGEYTNFSLKTTLFLCSLAEDVGVT-PHVVLVIAGLVEACAPE 109 >12_01_0016 + 125052-127145 Length = 697 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = -3 Query: 618 LILYFFFFDGC-SGLIESTSSPTVASVLVPVKPTSDATPNKYTCVLSI*NDT*PEAIFFL 442 L+L FFF G SG + SSP AS T+DA +LS+ D +A + L Sbjct: 23 LVLVPFFFSGSGSGTNNTASSPAAASSTHTHTHTADANAQLDAHLLSLLRDGHTDAAYHL 82 Query: 441 LFCSEFLTPEMVASHR 394 + L V++ R Sbjct: 83 FASNPSLPLSPVSASR 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,891,093 Number of Sequences: 37544 Number of extensions: 319343 Number of successful extensions: 806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -