BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0383 (720 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC364.05 |vps3||GTPase regulator Vps3 |Schizosaccharomyces pom... 28 1.2 SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 4.7 >SPCC364.05 |vps3||GTPase regulator Vps3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 910 Score = 28.3 bits (60), Expect = 1.2 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 30 SFSFCLITCSYHPKRAL-LSFSVTGATFRLPLTYSFYPFSLLHTSIATFA 176 S F LIT S PK A+ L G R LT+SFYP + TS FA Sbjct: 206 SNEFLLITGS--PKDAIGLFVDSQGNVTRSTLTFSFYPKHVFSTSHYVFA 253 >SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 871 Score = 26.2 bits (55), Expect = 4.7 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = -1 Query: 324 TKAFVGPVPY*FNVACATLGLECCL----IHKYSLECTETTKVADKR 196 T AFV + + F + CA +GL CL H Y C T+ +++ Sbjct: 9 TSAFVSSLVFNFAIFCAFIGLFLCLRPREKHVYQPRCIIDTQPKEEK 55 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,592,807 Number of Sequences: 5004 Number of extensions: 51602 Number of successful extensions: 129 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -