BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0372 (364 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 133 4e-32 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 126 4e-30 At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identic... 30 0.40 At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identic... 30 0.40 At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic... 30 0.40 At4g28730.1 68417.m04109 glutaredoxin family protein contains gl... 27 2.8 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 4.9 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 4.9 At5g42580.1 68418.m05184 cytochrome P450 family protein similar ... 26 8.6 At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative... 26 8.6 At1g42440.1 68414.m04894 expressed protein contains Pfam domain,... 26 8.6 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 133 bits (321), Expect = 4e-32 Identities = 58/88 (65%), Positives = 69/88 (78%) Frame = +1 Query: 40 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 219 MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60 Query: 220 KRTVAGGAWVFSTTAASSCRSAVRRLRE 303 + AGGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 126 bits (304), Expect = 4e-30 Identities = 56/88 (63%), Positives = 66/88 (75%) Frame = +1 Query: 40 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 219 M KRTKK I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C Sbjct: 1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60 Query: 220 KRTVAGGAWVFSTTAASSCRSAVRRLRE 303 + AGGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 545 Score = 30.3 bits (65), Expect = 0.40 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 24 GEVYQNGQTYQKGWNYW 74 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 428 Score = 30.3 bits (65), Expect = 0.40 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 24 GEVYQNGQTYQKGWNYW 74 G Y +G+TYQ W+YW Sbjct: 180 GSCYSSGETYQPRWDYW 196 >At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 516 Score = 30.3 bits (65), Expect = 0.40 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 24 GEVYQNGQTYQKGWNYW 74 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At4g28730.1 68417.m04109 glutaredoxin family protein contains glutaredoxin domain, Pfam:PF00462 Length = 174 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 70 TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 165 + +G+R S+RK V + V ++K CS+C Sbjct: 62 SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 4.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 245 QAPPATVLLHRLQDQMPTQERF 180 + PP TVL+ +LQ+ + + ERF Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 4.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 245 QAPPATVLLHRLQDQMPTQERF 180 + PP TVL+ +LQ+ + + ERF Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896 >At5g42580.1 68418.m05184 cytochrome P450 family protein similar to Cytochrome P450 93A1 (SP:Q42798) {Glycine max}; similar to flavone synthase II (GI:5081817) [Gerbera hybrida]. Length = 499 Score = 25.8 bits (54), Expect = 8.6 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 4/96 (4%) Frame = +1 Query: 19 VSERFTKMAKRTKKVG----ITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKR 186 VS RF + K + G +T YG Y ++K++ + HA + ++R Sbjct: 104 VSYRFVPVNKDSLVFGSSGFVTAPYGD-YWKFMKKLISTKLLRPHALELSKGNRAEELRR 162 Query: 187 SCVGIWSCKRCKRTVAGGAWVFSTTAASSCRSAVRR 294 C+ + R K +V G T CR ++ R Sbjct: 163 FCLDLQGKARKKESVEIGKVALKLTNNIICRMSMGR 198 >At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative strong similarity to ferredoxin--nitrite reductase [Nicotiana tabacum] GI:19893; contains Pfam profiles PF03460: Nitrite/Sulfite reductase ferredoxin-like half domain, PF01077: Nitrite and sulphite reductase 4Fe-4S domain Length = 586 Score = 25.8 bits (54), Expect = 8.6 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 196 GIWSCKRCKRTVAGGAWVFSTTAASSCRSAVRRLREV 306 G +S KRC+ + AWV + C++ + R++ Sbjct: 286 GFFSPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDL 322 >At1g42440.1 68414.m04894 expressed protein contains Pfam domain, PF04950: Protein of unknown function (DUF663) Length = 793 Score = 25.8 bits (54), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 5 LCQLLYRRGLPKWP 46 +C LY+R PKWP Sbjct: 772 VCMNLYKRAYPKWP 785 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,461,453 Number of Sequences: 28952 Number of extensions: 152067 Number of successful extensions: 477 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 467982008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -