BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0364 (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 29 3.6 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = -2 Query: 296 QPDTVRDTLA-YIPDRSRYN----DLFRTLNPLKARNTSDASDSAVGYSDATTTLTSLPE 132 QP R+ L +PDR Y+ D+FRT + +K S + D +TSL + Sbjct: 222 QPKDAREQLTTQLPDRVNYDAYDADIFRTTSNVKPLTDSILRQGSHSMPDVIPKVTSLTD 281 Query: 131 IRNL 120 I L Sbjct: 282 IERL 285 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,166,398 Number of Sequences: 59808 Number of extensions: 342809 Number of successful extensions: 647 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -