BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0362 (619 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 27 0.17 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 23 2.7 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 26.6 bits (56), Expect = 0.17 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 28 RVSHLRC-DLQEHGGYDIADHGHTRPQDWRWKEFES 132 + S +C D Q+ G + H + QDW WK+ E+ Sbjct: 71 KTSCAKCTDKQKQGAKTVIQHLYKNKQDW-WKQLEA 105 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 230 DSCVNFVEGTGGYVFSSTNFEK 295 DSC N + G Y F + NF++ Sbjct: 390 DSCSNILTGDQFYNFLNHNFDR 411 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,521 Number of Sequences: 336 Number of extensions: 2072 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -