BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0362 (619 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_05_0004 + 20021394-20023430 33 0.18 02_01_0405 - 2952434-2955583 32 0.42 05_05_0112 - 22480639-22480905,22480991-22481287,22481707-224818... 27 9.0 05_03_0024 - 7459352-7459765 27 9.0 01_05_0078 + 17931998-17932062,17933320-17933416,17933506-179336... 27 9.0 >09_05_0004 + 20021394-20023430 Length = 678 Score = 33.1 bits (72), Expect = 0.18 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = -2 Query: 351 CVIVLAAVWMNCFCCGAFNFSKLVDEKT*PPVPSTKFTHESSVF---WSVPLKVSESLVC 181 C+ + +WM+ C LVD P PST F V W+ +V+ SL+ Sbjct: 240 CLALFNQMWMSGLTCDDATLCILVDACAELPDPSTGFAIHKVVVQSGWNGIPEVNNSLIS 299 Query: 180 FFSPSSTTECSL 145 F++ S +C++ Sbjct: 300 FYTKFSLLDCAV 311 >02_01_0405 - 2952434-2955583 Length = 1049 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 146 SEHSVVLLGEKKQTKDSETLRGTLQKTDDSCVNFVEGTGGY 268 SEH +V+L + K+ +D T G ++ T++ + G GGY Sbjct: 740 SEHLLVMLQQGKEAEDKITFTGIMEATNNFNREHIIGCGGY 780 >05_05_0112 - 22480639-22480905,22480991-22481287,22481707-22481836, 22482167-22482492,22482609-22482830,22483372-22483684, 22483795-22483850 Length = 536 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 107 IGGGKNLNQVVGFSEHSVVLLGEKKQTKDSETLRGTL-QKTDDSCVNFVEG 256 +GGG+NLN + S + VL G + T+ + Q+T D V+ EG Sbjct: 50 LGGGENLNDPLKESNNGPVLQGFNGSSASFRTVGAKITQETGDFFVSDAEG 100 >05_03_0024 - 7459352-7459765 Length = 137 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 355 APQRAAVSALYLHLRGSV 408 AP+RAA SAL LH+ G V Sbjct: 20 APRRAATSALRLHITGDV 37 >01_05_0078 + 17931998-17932062,17933320-17933416,17933506-17933601, 17933957-17933988,17935143-17935595,17935831-17935975, 17936058-17936159,17937798-17937890,17939448-17939489, 17940092-17940202,17940446-17940517,17940596-17940714, 17940981-17941044,17941133-17942782 Length = 1046 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 315 FCCGAFNFSKLVDEK 271 FCCGA +FS+L+ EK Sbjct: 379 FCCGANDFSRLMKEK 393 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,343,259 Number of Sequences: 37544 Number of extensions: 265334 Number of successful extensions: 651 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -