BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0353 (763 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000DD7972 Cluster: PREDICTED: hypothetical protein;... 33 5.8 UniRef50_Q75C93 Cluster: ACR023Wp; n=1; Eremothecium gossypii|Re... 33 5.8 >UniRef50_UPI0000DD7972 Cluster: PREDICTED: hypothetical protein; n=2; Homo sapiens|Rep: PREDICTED: hypothetical protein - Homo sapiens Length = 139 Score = 33.5 bits (73), Expect = 5.8 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +2 Query: 5 LPRPSDPKPTSPARGAPCRSTNEALARRGRHGTTVAYIVDDSGSDHKFP 151 LPR + P P+ PA+ P RS E RG + DD G FP Sbjct: 56 LPRVAPPPPSPPAQARPLRSP-ETRGHRGVAAVPLGLCADDLGGRSAFP 103 >UniRef50_Q75C93 Cluster: ACR023Wp; n=1; Eremothecium gossypii|Rep: ACR023Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 769 Score = 33.5 bits (73), Expect = 5.8 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 8 PRPSDPKPTSPARGAPCRSTNEALARRGRH 97 P P DP+PTSPA+ A R ++ +L G H Sbjct: 550 PPPGDPQPTSPAQNATRRPSDASLGYPGSH 579 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,748,764 Number of Sequences: 1657284 Number of extensions: 12505876 Number of successful extensions: 30982 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30917 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63381147830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -