BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0353 (763 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g06860.1 68415.m00768 Ulp1 protease family protein contains P... 30 1.5 At3g24065.1 68416.m03022 expressed protein ; expression supporte... 28 5.9 At2g16990.1 68415.m01959 expressed protein 28 7.8 >At2g06860.1 68415.m00768 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 938 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +2 Query: 383 LSQVSGVNVSPKNTGDTRIVINYDYYN*FKHSTFKSFRYCGCDSMINVD 529 +S V+G SPK +GD V Y YY H TF + C + NVD Sbjct: 483 ISSVTGAVTSPKLSGDNEEVSCYPYYQ--NHYTFIVVQ-CSQQTTTNVD 528 >At3g24065.1 68416.m03022 expressed protein ; expression supported by MPSS Length = 135 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/66 (25%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Frame = -1 Query: 379 LRLINVSLPYFGD-TFTH-IMTIRIKSTPKALDSNPYYWKCFTSLI*K*NGVSMTAKSYI 206 L L++++L + +FT + T+++ + ALDS+P+ +C +S + + V ++Y+ Sbjct: 9 LFLVSLALAFTSSLSFTAPVFTVKVTNN-LALDSHPFTIRCTSSKLDTSSQVLFRGETYV 67 Query: 205 SKYDTE 188 +DT+ Sbjct: 68 LMFDTD 73 >At2g16990.1 68415.m01959 expressed protein Length = 456 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 279 GLLSKALGVDFILIVIICVNVSPKYGSDTLINLSYCL 389 G A+G+ ++++ + N+S +YG T++ L CL Sbjct: 53 GFQQVAIGMGTMIMMPVIGNLSDRYGIKTILTLPMCL 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,532,395 Number of Sequences: 28952 Number of extensions: 271160 Number of successful extensions: 590 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -