BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0350 (731 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 32 0.004 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 24 1.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 2.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 3.4 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 23 3.4 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 32.3 bits (70), Expect = 0.004 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +2 Query: 5 LQKIDEMEFNVLQPSPLNEKVLKEQKKKTQGNF*QSPQNV*QR*AREMGRSQTSRNG 175 LQ+ D E +L+ +P ++ +L ++K K G P V +R ARE R + NG Sbjct: 15 LQQNDRREIIILRKNPQDDILLTKKKSKPGGKTAPQPVAVARRNARERNRVKQVNNG 71 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 61 KSIERAKEK--NSRKLLTESSKCMTKMSQRNG*ISNVKKWN 177 K IERA N KLLT +C T + + G ++ N Sbjct: 338 KGIERADSVTWNPHKLLTAPQQCSTLLLRHEGVLAEAHSTN 378 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 176 FHFLTFEIYPFLWLIFVI 123 F+F E + LW++FVI Sbjct: 20 FYFFETEQFTLLWVLFVI 37 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 122 HFEDSVKSFLEFFSFALSILF 60 H SVK F E F +L +LF Sbjct: 232 HLSKSVKLFNEVFGVSLLVLF 252 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 122 HFEDSVKSFLEFFSFALSILF 60 H SVK F E F +L +LF Sbjct: 250 HLSKSVKLFNEVFGVSLLVLF 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,770 Number of Sequences: 336 Number of extensions: 3718 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -