BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0348 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 72 5e-15 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 2.5 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 5.8 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 7.7 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 71.7 bits (168), Expect = 5e-15 Identities = 41/121 (33%), Positives = 67/121 (55%) Frame = +2 Query: 260 YR*IYEYEFYRGTIAAETARRINYVYGAGVATESTVRFWFQRFRSGNFDLQNQPRGRLET 439 YR I + F +G A++ +++ VYG E + WF +FRSG+F L+++ R Sbjct: 8 YRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFDKFRSGDFSLKDEKRSGRPV 67 Query: 440 KVENEELKVIVEADQSQSTSEIAAGFGVSDKTVLIHLTQTGERQKPFERYVVPHERSEWE 619 +V+++ +K I+++D+ +T EIA VS + HL Q G QK + + VPHE E Sbjct: 68 EVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQK-LDTW-VPHELKEKH 125 Query: 620 L 622 L Sbjct: 126 L 126 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 370 FLVSTFSFWKFR 405 +L STF FWK R Sbjct: 21 YLTSTFDFWKSR 32 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 62 SVHIVCPRLGINRSAL 15 SVHI P+L NR+ L Sbjct: 281 SVHIKLPKLAANRAKL 296 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 422 RGRLETKVENEELKVIVEADQSQST 496 RG+L TK+E+ E + V++ + T Sbjct: 396 RGQLRTKIESGEGTIPVKSSEGIQT 420 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,665 Number of Sequences: 438 Number of extensions: 3973 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -