BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0345 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.1 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.5 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +1 Query: 196 EVLIPLYAEVDPKKSMWVNKGRLIEVLLAKEKVDEPYWPSLTSDKKKHHWL 348 E LI L P W+ + L ++L K ++ W LT H W+ Sbjct: 493 EPLIELIEHWMPLLPNWILENILDMLVLPKLTLEVEEWNPLTDTVPIHTWI 543 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -1 Query: 195 VHFFFWFAYSFERNRFRF 142 ++ F+WFAY R + Sbjct: 438 INVFYWFAYLSRSERINY 455 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,758 Number of Sequences: 438 Number of extensions: 3571 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -