BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0342 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.96 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 3.9 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 22 5.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.9 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.6 bits (51), Expect = 0.96 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -2 Query: 195 AIVCSSVADVLRKTPPKVPNGVLLAPTMKIPLTEADMIQNYTYPVN 58 A+V SS + ++ PP PNGV+ T+ A+ + P N Sbjct: 1188 ALVMSSESILVSWRPPSQPNGVITQYTVYTKADNAEEPTSQKVPPN 1233 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 208 LEGGRSVPGSGRQH 249 L G S PG+GR+H Sbjct: 389 LVSGSSTPGTGREH 402 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +1 Query: 289 NLHATSRGAQSWYSSREAGARHQQTVRL 372 +LH T + W+ +R A A+ Q + Sbjct: 45 SLHLTETQVKIWFQNRRAKAKRLQEAEI 72 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 260 GPRPCCRPEPGTLRPPSRHQ 201 G RP PG ++PP++HQ Sbjct: 108 GKRPA---SPGYVQPPTKHQ 124 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 8.9 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = +1 Query: 499 GSGHQLRLRRHPLGRTLGLILRTPHGHDRREARSPVRNHQRRS*QLRSTIATEVGRL 669 GS + H +G T+G PH H + +S H R+ L + ++ V + Sbjct: 331 GSSPHHQHGNHTMGPTMG----PPHHHHHHQTQSLQHLHYRQPPTLSESYSSYVNSM 383 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,760 Number of Sequences: 438 Number of extensions: 4061 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -