BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0341 (500 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 3.3 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.7 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.8 bits (49), Expect = 3.3 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 324 LETERAELECLPKDPQSAVEWYRQGALLNQLPELAA 431 LE R ECLP+ +S + Y Q QL +L A Sbjct: 819 LEELRVRFECLPQANESVADEYAQKK--RQLEQLRA 852 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 7.7 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +3 Query: 12 GHEIPYRLQWDKDGETIFSWYS 77 G+ I ++ WD++ E + W S Sbjct: 311 GNPICVQIPWDRNAEALAKWAS 332 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 393,905 Number of Sequences: 2352 Number of extensions: 5779 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -