BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0340 (668 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4H3.07c |||protein phosphatase Fmp31 |Schizosaccharomyces po... 26 4.3 SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces po... 26 4.3 >SPAC4H3.07c |||protein phosphatase Fmp31 |Schizosaccharomyces pombe|chr 1|||Manual Length = 171 Score = 26.2 bits (55), Expect = 4.3 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 305 EVFLNIHSFPYVLFQRH*STKCRSPRMSALSISIFTRICYIHFINY 168 E F + F +F+ + CRS R S + I T++ Y + NY Sbjct: 112 EEFSKTYGFSKPVFEDNVVVYCRSGRRSTTASDILTKLGYKNIGNY 157 >SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces pombe|chr 1|||Manual Length = 1159 Score = 26.2 bits (55), Expect = 4.3 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = +1 Query: 421 FNPVLPKKA--WSDCFTLFERISQ*DLKHFHTLH-SSYLKKKI 540 F P PK+ +++ TLF+R + LK ++LH SS L KK+ Sbjct: 110 FEPRKPKQKQDYTNSPTLFKRHDELSLKSLNSLHPSSALSKKL 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,436,087 Number of Sequences: 5004 Number of extensions: 47365 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -