BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0327 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 137 3e-34 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 2.3 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 2.3 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 4.0 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 4.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.0 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 5.3 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 7.0 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 7.0 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 7.0 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 7.0 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 7.0 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 7.0 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 7.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.0 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 7.0 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.0 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 137 bits (331), Expect = 3e-34 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = +2 Query: 188 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 367 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 368 GGGTFDVSILTIEDG 412 GGGTFDVSILTI++G Sbjct: 61 GGGTFDVSILTIDEG 75 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 2.3 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 2.3 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.0 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.0 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 487 LCPGVQEEIQKGPRYQQESS*RL 555 L PG+QE I + R QQE+ R+ Sbjct: 2077 LSPGLQEVIDRFVRIQQENGHRI 2099 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 5.3 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%) Frame = -3 Query: 444 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 307 +SP +F++ S++ ++ + PPP RSK T RS PVPF L+ P A Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498 Query: 306 AAAVGSLMIR 277 + A G +R Sbjct: 499 SPAFGDRSVR 508 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 178 NCAECSYHGSRVLQ*LSKTSHKR-CRY 255 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 178 NCAECSYHGSRVLQ*LSKTSHKR-CRY 255 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 178 NCAECSYHGSRVLQ*LSKTSHKR-CRY 255 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 178 NCAECSYHGSRVLQ*LSKTSHKR-CRY 255 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.0 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.0 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 7.0 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ P++ PPP + +T Sbjct: 221 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 253 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 423 TSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLS-RP*AIAAA 298 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 572 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 614 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 7.0 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 447 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 349 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 423 TSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLS-RP*AIAAA 298 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 571 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,037 Number of Sequences: 2352 Number of extensions: 12689 Number of successful extensions: 41 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -