BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0322 (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14540.1 68418.m01704 proline-rich family protein contains pr... 36 0.015 At5g51800.1 68418.m06423 expressed protein 30 0.75 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 30 1.00 At2g48160.1 68415.m06031 PWWP domain-containing protein 29 1.3 At4g23380.1 68417.m03371 hypothetical protein predicted proteins... 29 2.3 At2g35230.2 68415.m04322 VQ motif-containing protein contains PF... 29 2.3 At2g35230.1 68415.m04321 VQ motif-containing protein contains PF... 29 2.3 At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar ... 28 3.0 At4g31630.1 68417.m04493 transcriptional factor B3 family protei... 28 3.0 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 28 3.0 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 28 4.0 At1g20760.1 68414.m02600 calcium-binding EF hand family protein ... 28 4.0 At5g52850.1 68418.m06560 pentatricopeptide (PPR) repeat-containi... 27 5.3 At4g17090.1 68417.m02575 beta-amylase (CT-BMY) / 1,4-alpha-D-glu... 27 5.3 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 27 5.3 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 27 7.0 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 27 7.0 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 27 7.0 At4g23250.1 68417.m03352 protein kinase family protein contains ... 27 7.0 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 7.0 At1g64150.1 68414.m07267 expressed protein contains Pfam profile... 27 9.3 At1g18830.1 68414.m02345 transducin family protein / WD-40 repea... 27 9.3 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 35.9 bits (79), Expect = 0.015 Identities = 19/69 (27%), Positives = 28/69 (40%) Frame = -3 Query: 332 PQHPVVPDIPQEGAENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQPAEVEGHSMPL 153 PQ P+ P++ + P + + PT P YD PG + P+ S P Sbjct: 359 PQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGRSNSGFPSGYSPESYPY 418 Query: 152 QCPPYNYGS 126 PP YG+ Sbjct: 419 TGPPSQYGN 427 >At5g51800.1 68418.m06423 expressed protein Length = 972 Score = 30.3 bits (65), Expect = 0.75 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -2 Query: 315 TRYSTRGGREPTPAEHHARPENDEGSHRTR---YIRPTWPPN 199 T S+ G+E T +E +P+ + H+ R Y+ P W PN Sbjct: 113 TAGSSPPGQEATNSEKQQQPKTESFQHKFRKGKYVSPVWKPN 154 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.9 bits (64), Expect = 1.00 Identities = 30/111 (27%), Positives = 36/111 (32%), Gaps = 1/111 (0%) Frame = -3 Query: 470 QPPYPSDDEGHSRCGETGRLPKIIPPGHDQRVVRVTNNAEAREEGAPQ-HPVVPDIPQEG 294 +PP P+ GH R +P GH R R +N G Q P P P Sbjct: 49 RPPLPATTAGHHRQLRPPSIPVTTNTGH--RHCRPPSNPATTNSGHHQLRPPPPPPPPLS 106 Query: 293 AENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQPAEVEGHSMPLQCPP 141 A TT + P P P P I P GH + PP Sbjct: 107 A-----ITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPP 152 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 302 QEGAENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQPAE 177 Q G ++RP+ T+H ++ P +P + P P P+Q E Sbjct: 1117 QLGQQHRPVFGTSHQHMSLSSPPLPSS-SPPPPPAPPSQQGE 1157 >At4g23380.1 68417.m03371 hypothetical protein predicted proteins, Arabidopsis thaliana Length = 400 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 278 LRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQPAEVEGHSMP 156 LRN + K P P TYD G ++GP Q +++G S P Sbjct: 79 LRNHSVKLKPTSVPKWPITYDNKGQKVGPMQ-LQLKGISCP 118 >At2g35230.2 68415.m04322 VQ motif-containing protein contains PF05678: VQ motif Length = 295 Score = 28.7 bits (61), Expect = 2.3 Identities = 24/84 (28%), Positives = 32/84 (38%) Frame = -3 Query: 437 SRCGETGRLPKIIPPGHDQRVVRVTNNAEAREEGAPQHPVVPDIPQEGAENRPLRNTTHD 258 S G++G + PGH+QR + G Q P +P G E RP Sbjct: 53 SSLGDSGPNANQMQPGHEQRPYIPGHEQRPYVPGNEQQPYMP-----GNEQRPYIPGHEQ 107 Query: 257 RKTMKGPTVPGTYDRPGPQIGPNQ 186 R M P + +P PQ P Q Sbjct: 108 RSYM--PAQSQSQSQPQPQPQPQQ 129 >At2g35230.1 68415.m04321 VQ motif-containing protein contains PF05678: VQ motif Length = 402 Score = 28.7 bits (61), Expect = 2.3 Identities = 24/84 (28%), Positives = 32/84 (38%) Frame = -3 Query: 437 SRCGETGRLPKIIPPGHDQRVVRVTNNAEAREEGAPQHPVVPDIPQEGAENRPLRNTTHD 258 S G++G + PGH+QR + G Q P +P G E RP Sbjct: 160 SSLGDSGPNANQMQPGHEQRPYIPGHEQRPYVPGNEQQPYMP-----GNEQRPYIPGHEQ 214 Query: 257 RKTMKGPTVPGTYDRPGPQIGPNQ 186 R M P + +P PQ P Q Sbjct: 215 RSYM--PAQSQSQSQPQPQPQPQQ 236 >At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar to variable surface lipoprotein Vsp422-3 (GI:15384285) [Mycoplasma bovis]; similar to glycine-rich protein atGRP-6, Arabidopsis thaliana, PIR:T49893 Length = 225 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 279 PAEHHARPENDEGSHRTRYIRPTWPPNRTQPAGGGR 172 PAE H P+ D+ + + + PP + +PA G + Sbjct: 166 PAEGHKPPQKDKPAEGDKPVEEDKPPQKDKPAEGDK 201 >At4g31630.1 68417.m04493 transcriptional factor B3 family protein similar to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 512 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/68 (25%), Positives = 26/68 (38%) Frame = -3 Query: 455 SDDEGHSRCGETGRLPKIIPPGHDQRVVRVTNNAEAREEGAPQHPVVPDIPQEGAENRPL 276 + +GH R+ P +Q RV A+ EEG P D P + +P Sbjct: 407 ASSDGHKTADRKPRMTDQAPLAEEQTDNRVEKRAQVTEEGGPSRSTRAD-PGNLQQKQPC 465 Query: 275 RNTTHDRK 252 + H +K Sbjct: 466 SISDHVKK 473 >At4g19920.1 68417.m02918 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 274 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 471 PASLSFRRRGPLPLWRDGQTP*NHPPGPRP 382 P L R R PLP R Q P + PP PRP Sbjct: 21 PPVLLTRPRPPLPYARPLQPPQSLPPRPRP 50 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 27.9 bits (59), Expect = 4.0 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -1 Query: 298 RGPRTDPCGTPRTTGKR*RVPPYPVHTTDLAPK*DPTSRRR*RGTPCLSSAPP 140 R P P PRT + P P T P P S G+P SSA P Sbjct: 30 RSPLPSPAQPPRTAAPTPSITPTPTPTPSATPTAAPVSPP--AGSPLPSSASP 80 >At1g20760.1 68414.m02600 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 1019 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = -3 Query: 308 IPQEGAENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQP 183 + Q G RP+ TT R P VP +PG I PNQP Sbjct: 470 VQQPGMGARPITPTTGMR-----PPVPAPGPQPGSGIPPNQP 506 >At5g52850.1 68418.m06560 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 893 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 201 LGARSVVCTGYGGTLHRFPVVRGVPQGSVL 290 LGA S + +G T+H +VRG+P VL Sbjct: 232 LGASSFLGLEFGKTIHSNIIVRGIPLNVVL 261 >At4g17090.1 68417.m02575 beta-amylase (CT-BMY) / 1,4-alpha-D-glucan maltohydrolase identical to beta-amylase enzyme GI:6065749 from [Arabidopsis thaliana] Length = 548 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 122 LSYHSYRGGTGEAWSAPLPPPAGWVL 199 +S+H G G++ S PLPP WVL Sbjct: 164 MSFHQCGGNVGDSCSIPLPP---WVL 186 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -3 Query: 281 PLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQPAEVEGHSMPLQCPPYNYGS 126 PL ++ + K P P Y P P + + +V+ S P PPY Y S Sbjct: 17 PLYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPP---PPYVYSS 65 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/54 (29%), Positives = 20/54 (37%) Frame = -3 Query: 344 EEGAPQHPVVPDIPQEGAENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQP 183 ++ PQH P PQ + +P H P PG YD P P P Sbjct: 71 QQQQPQHLPHPPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPPPADP 124 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 288 EPTPAEHHARPENDEGSHRTRYIRPTWPPNRTQPAGGGRGALHAS 154 +P P HARP+ D+ +H R + P + G G L+ + Sbjct: 241 QPHPFAPHARPDFDQSTHAFRGLSGPLPADVAMELNGVLGNLNGT 285 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/54 (29%), Positives = 20/54 (37%) Frame = -3 Query: 344 EEGAPQHPVVPDIPQEGAENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQP 183 ++ PQH P PQ + +P H P PG YD P P P Sbjct: 71 QQQQPQHLPHPPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPPPADP 124 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 288 EPTPAEHHARPENDEGSHRTRYIRPTWPPNRTQPAGGGRGALHAS 154 +P P HARP+ D+ +H R + P + G G L+ + Sbjct: 241 QPHPFAPHARPDFDQSTHAFRGLSGPLPADVAMELNGVLGNLNGT 285 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/54 (29%), Positives = 20/54 (37%) Frame = -3 Query: 344 EEGAPQHPVVPDIPQEGAENRPLRNTTHDRKTMKGPTVPGTYDRPGPQIGPNQP 183 ++ PQH P PQ + +P H P PG YD P P P Sbjct: 71 QQQQPQHLPHPPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPPPADP 124 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 288 EPTPAEHHARPENDEGSHRTRYIRPTWPPNRTQPAGGGRGALHAS 154 +P P HARP+ D+ +H R + P + G G L+ + Sbjct: 241 QPHPFAPHARPDFDQSTHAFRGLSGPLPADVAMELNGVLGNLNGT 285 >At4g23250.1 68417.m03352 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 998 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 5/52 (9%) Frame = -3 Query: 302 QEGAENRPLRNTTH-----DRKTMKGPTVPGTYDRPGPQIGPNQPAEVEGHS 162 QE +RP +T H T+ P PG + R GP P+ V G S Sbjct: 596 QENPADRPTMSTIHQVLTTSSITLPVPQPPGFFFRNGPGSNPSSQGMVPGQS 647 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.1 bits (57), Expect = 7.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 480 RRDPASLSFRRRGPLPLWRDGQTP 409 RR P+ + RRR P PL+R ++P Sbjct: 379 RRSPSPPARRRRSPSPLYRRNRSP 402 >At1g64150.1 68414.m07267 expressed protein contains Pfam profile PF01169: Uncharacterized protein family UPF0016 Length = 370 Score = 26.6 bits (56), Expect = 9.3 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 87 KSIYEAISAKVA*ATI-VIGGALERHGVPLYLRRLVGSYLG 206 KS + I+ A + + VI GAL HG L L GS LG Sbjct: 301 KSFFSTIALAAASSPLGVIAGALAGHGAATLLAVLGGSLLG 341 >At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat family protein similar to Sec31p (GI:13928450) {Oryza sativa} Length = 969 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 122 LSYHSYRGGTGEAWSAPLPPPAGWVLFGGQVG 217 + YHS+ G A++AP P P + QVG Sbjct: 781 MDYHSFNRSAGPAYNAP-PGPGSYRSIHSQVG 811 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,483,171 Number of Sequences: 28952 Number of extensions: 316367 Number of successful extensions: 878 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -