BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0317 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) 270 8e-73 SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) 38 0.005 SB_59495| Best HMM Match : RnaseH (HMM E-Value=0.0011) 30 1.7 SB_53135| Best HMM Match : RnaseH (HMM E-Value=0.0016) 30 1.7 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 29 3.0 SB_54650| Best HMM Match : IncA (HMM E-Value=0.84) 29 3.0 SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) 29 3.9 SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) 28 6.9 SB_20469| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_2184| Best HMM Match : AMP-binding (HMM E-Value=8.5e-06) 27 9.1 SB_41444| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) 27 9.1 >SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) Length = 212 Score = 270 bits (661), Expect = 8e-73 Identities = 126/164 (76%), Positives = 142/164 (86%) Frame = +1 Query: 121 EVEADQLGDEWKGYVLRVAGGNDKQGFPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKR 300 EV + LGDEWKGYV R+ GGNDKQGFPMKQG++TN RVRLL+SKGHSCYRPRR GERKR Sbjct: 2 EVSGECLGDEWKGYVFRITGGNDKQGFPMKQGIMTNGRVRLLLSKGHSCYRPRRTGERKR 61 Query: 301 KSVRGCIVDANLSVLALVIVRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLXKEDDVR 480 KSVRGCIVD+ LSVL+LVIV+KG Q+IPGLTD +PRRLGPKR KIRK+FNL KEDDVR Sbjct: 62 KSVRGCIVDSQLSVLSLVIVKKGEQDIPGLTDNTIPRRLGPKRVGKIRKMFNLSKEDDVR 121 Query: 481 RYVVKRVLPAKEGKENAKPRHKAPKIQRLVTPVVLQRRRHRLAL 612 +YV++R LP KEGK K + KAPKIQRLVTPVVLQR+R RLAL Sbjct: 122 QYVIRRPLPEKEGK---KAKSKAPKIQRLVTPVVLQRKRKRLAL 162 >SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) Length = 796 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = -1 Query: 261 VAL*HQKTNTAVCQDALFHRESLLVVAASDTKYIALPFIA*LISLYFGAHALFVK 97 V L Q+ + A+ D L H +SL V+ SD + ++LP I + Y H L ++ Sbjct: 252 VTLGEQEADAAIGHDPLLHGKSLFVITTSDPEDVSLPLIPQALPRYLHGHTLVIE 306 >SB_59495| Best HMM Match : RnaseH (HMM E-Value=0.0011) Length = 515 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 476 YVVMSSNACSQPRKEKKMLNPDIRHLRSRG 565 Y V + C+ PR K+L P + HLR +G Sbjct: 50 YSVFPNGLCTCPRNFTKLLKPPLSHLRLKG 79 >SB_53135| Best HMM Match : RnaseH (HMM E-Value=0.0016) Length = 515 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 476 YVVMSSNACSQPRKEKKMLNPDIRHLRSRG 565 Y V + C+ PR K+L P + HLR +G Sbjct: 50 YSVFPNGLCTCPRNFTKLLKPPLSHLRLKG 79 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 307 VRGCIVDANLSVLALVIVRKGAQEIPGLTDGNVPRRLGPKRASKIRK 447 VR C +D +VLA + + A E GLT+G V GP R +++ Sbjct: 86 VRSCPMDKQSTVLA--VETREACESKGLTEGCVSSAFGPGREEPVQE 130 >SB_54650| Best HMM Match : IncA (HMM E-Value=0.84) Length = 291 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 397 GNVPRRLGPKRASKIRKLFNLXKEDDVRRYVVK 495 G+ + GP + SKI K+ ++DDV+ VVK Sbjct: 221 GSEAAKTGPNKLSKIDKVILAVEDDDVQEIVVK 253 >SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) Length = 1365 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +1 Query: 127 EADQLGDEWKGYVL--RVAGGNDKQGFPMK 210 E D+ G EW+G+V G D QG+ MK Sbjct: 815 EEDRTGQEWEGHVCDKEPEGKRDNQGYKMK 844 >SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) Length = 273 Score = 27.9 bits (59), Expect = 6.9 Identities = 26/86 (30%), Positives = 40/86 (46%) Frame = +1 Query: 289 ERKRKSVRGCIVDANLSVLALVIVRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLXKE 468 + K KSV+ VD + S L R AQE L DG ++L A K +L KE Sbjct: 191 DNKNKSVKATTVDKSASENKLKRKRNSAQE--NLDDGVKRKKLKDAGAMK-----SLVKE 243 Query: 469 DDVRRYVVKRVLPAKEGKENAKPRHK 546 ++ + V +R +E ++ K + K Sbjct: 244 LELEKLVEQRSELVQEKQKKKKEKEK 269 >SB_20469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 271 CNMSGPLTSEDEHGCLSGRPVSSGILACR 185 C S L +E GC S RP+ SG +CR Sbjct: 105 CTSSAVLPAEKGGGCTSARPIRSG--SCR 131 >SB_2184| Best HMM Match : AMP-binding (HMM E-Value=8.5e-06) Length = 757 Score = 27.5 bits (58), Expect = 9.1 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = +1 Query: 364 KGAQEIPGLTDGNV----PRRLGPK---RASKIRKLFNLXKEDDVRRYVVKRVLPAKEGK 522 +GA+++P L +G V P + G K R++ +++L E DVR + RV ++ Sbjct: 267 RGARDVPPLEEGGVVRMRPFKFGKKHWDRSTVVKRLGEYEVETDVRTHRRHRVGLKEQNL 326 Query: 523 ENAKPRHKAP 552 A P+ P Sbjct: 327 PPATPQEADP 336 >SB_41444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 445 KLFNLXKEDDVRRYVVKRVLPAKEGKENAKPRHKAPKIQR 564 + F++ KEDD+ Y++ L + K NA ++ P+ R Sbjct: 137 RAFDVTKEDDITMYIIITPLFMRARKNNAMEYNQKPRDPR 176 >SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1101 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 430 ASKIRKLFNLXKEDDVRRYVVKRVLPAKEGKENAKPR 540 A ++ + + DDV+ ++K ++P KEG E+ P+ Sbjct: 22 AGLVQNILDEDIPDDVKHRLLKPLVPEKEGPESLDPK 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,285,710 Number of Sequences: 59808 Number of extensions: 456218 Number of successful extensions: 1366 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1364 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -