BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0307 (364 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 22 1.7 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 3.9 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 5.1 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 20 6.8 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 20 9.0 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.2 bits (45), Expect = 1.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 217 VLRTIEGPIRAMVSKDLPDNEFDEDDATLRPAF 315 V T P+ + +LP ++ E ATL PAF Sbjct: 63 VSNTNTEPLLSEALTNLPGEKWKEMRATLSPAF 95 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.0 bits (42), Expect = 3.9 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +3 Query: 120 LEFSCGALPRKRRTTDGNSKDIRQLRGRSEARCTENHRGSDPSDGVQGPARQR 278 L+ G L RKR+ S+ +R + + R + + PS+G++ R + Sbjct: 344 LDSEPGMLKRKRQKYHDPSQLLRHVEESDKQRTHQPFLLNIPSEGIKVEPRDK 396 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 20.6 bits (41), Expect = 5.1 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -1 Query: 274 CRAGPWTPSL 245 C GPW PS+ Sbjct: 467 CGFGPWKPSM 476 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.2 bits (40), Expect = 6.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 100 ENLHKLCLNLVVALFPEKEG 159 +NL K CL L L +K+G Sbjct: 403 KNLVKKCLELFEELAEDKDG 422 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 19.8 bits (39), Expect = 9.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +1 Query: 322 LLENCPRGAE 351 L+ NCPRG + Sbjct: 22 LITNCPRGGK 31 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,243 Number of Sequences: 336 Number of extensions: 1420 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7404950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -