BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0298 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putativ... 84 7e-17 At1g78955.1 68414.m09205 beta-amyrin synthase, putative similar ... 27 9.1 >At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putative similar to NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (Swiss-Prot:Q01300) [Petunia hybrida] Length = 99 Score = 84.2 bits (199), Expect = 7e-17 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 2/99 (2%) Frame = +2 Query: 35 LGYIQIRKGPNKVGFIGLLQPFSDAIKLFTKERTYPNFSNYFCYYFSPVFRFIXXXXXXX 214 + ++Q RKGP+ VG GLLQP +D KL KE P+ +N+F + +PV F+ Sbjct: 1 MAFVQRRKGPDVVGSFGLLQPLADGSKLILKEPISPSSANFFLFRMAPVATFMLSLVARA 60 Query: 215 XIPYIYNLICF--NLGILFFLCLTSLGVYIVIIAGWSSN 325 +P+ Y ++ N+G+L+ ++SLGVY +IIAG SSN Sbjct: 61 VVPFDYGMVLSDPNIGLLYLFAISSLGVYGIIIAGRSSN 99 >At1g78955.1 68414.m09205 beta-amyrin synthase, putative similar to beta-Amyrin Synthase GI:3688600 from [Panax ginseng] and GI:8918271 from [Pisum sativum] Length = 769 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -3 Query: 636 IQPKKLKQ-IPPLLYSILNPETNSLSPSAKSKGVRFVSA 523 ++ KK +Q IPP N T+ ++ +A KGV F+SA Sbjct: 70 LKEKKFEQVIPPAKVEDANNITSEIATNALRKGVNFLSA 108 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,141,846 Number of Sequences: 28952 Number of extensions: 112230 Number of successful extensions: 311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 310 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -