BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0294 (732 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 85 4e-19 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 85 4e-19 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 80 2e-17 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.4 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 4.4 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 85.4 bits (202), Expect = 4e-19 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +3 Query: 582 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIF 716 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIF Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIF 45 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 85.4 bits (202), Expect = 4e-19 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +3 Query: 582 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIF 716 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIF Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIF 45 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 79.8 bits (188), Expect = 2e-17 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = +3 Query: 582 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIF 716 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+F Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVF 44 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.5 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 354 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 479 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 537 TKDAGTISSLNVLRIINEPTAA 602 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 125 LPAREGGDHRQRPGQQDH 178 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.2 bits (45), Expect = 4.4 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%) Frame = +2 Query: 425 FH-GAYENEGNCRSL------SRQNCAECSYHGSRVLQ*LSKTSHKRCR 550 FH GA+ EG C+S + + +EC +G V+ ++T+ K CR Sbjct: 15 FHFGAFTCEG-CKSFFGRTYNNISSISECKNNGECVINKKNRTACKACR 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,746 Number of Sequences: 336 Number of extensions: 3960 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -