BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0285 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 1.9 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 5.8 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 7.7 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 7.7 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 7.7 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 158 SSPVMTRESLIKQINTQHFCANILKINNFYYSLAERKNLSGI 283 S+P+M ++ + F N+L I N Y+ E + G+ Sbjct: 261 SNPIMWDRVMLLTFWSAFFIVNVLYICNQCYNTVEESRIFGL 302 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 8 LTPHIVLVFPYLIQCIE 58 + P +VL+F Y CIE Sbjct: 213 MVPLVVLIFTYTSICIE 229 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.4 bits (43), Expect = 7.7 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +2 Query: 311 TGNIFFTKISEEMKMSLQVLRPSGEFETIKVAGLSQSTTVDNLNDI 448 T I K ++ ++ RP + IK S TVD NDI Sbjct: 153 TLKILLGKYTQLKACLMEEKRPMVSLQVIKAQIYSLRETVDVFNDI 198 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.4 bits (43), Expect = 7.7 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +2 Query: 311 TGNIFFTKISEEMKMSLQVLRPSGEFETIKVAGLSQSTTVDNLNDI 448 T I K ++ ++ RP + IK S TVD NDI Sbjct: 153 TLKILLGKYTQLKACLMEEKRPMVSLQVIKAQIYSLRETVDVFNDI 198 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 7.7 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +2 Query: 311 TGNIFFTKISEEMKMSLQVLRPSGEFETIKVAGLSQSTTVDNLNDI 448 T I K ++ ++ RP + IK S TVD NDI Sbjct: 473 TLKILLGKYTQLKACLMEEKRPMVSLQVIKAQIYSLRETVDVFNDI 518 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,942 Number of Sequences: 336 Number of extensions: 3615 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -