BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0284 (677 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B9.03c ||SPAC6B12.01|RNA-binding protein|Schizosaccharomyce... 27 3.3 SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch... 26 5.8 SPAC11E3.08c |nse6||Smc5-6 complex non-SMC subunit Nse6|Schizosa... 25 7.6 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 7.6 >SPAC1B9.03c ||SPAC6B12.01|RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 605 IVSREDFCANLNTLRKNRGRYLHIPLFNYRIS 510 ++SR D ANL +R RG LH + Y ++ Sbjct: 86 VLSRTDNNANLRIIRAPRGPSLHFRIHEYMLN 117 >SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1362 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 522 LSNKLNAKDCMRFENNVISKIFSE 451 L+NKLN KD + FE+ + + SE Sbjct: 720 LNNKLNEKDNVVFEDKTLQHVASE 743 >SPAC11E3.08c |nse6||Smc5-6 complex non-SMC subunit Nse6|Schizosaccharomyces pombe|chr 1|||Manual Length = 522 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 340 SIQNIYPRDTPYAFMTLNEISNCLNKNVIRNVI 242 ++QN+ D+ F T +EI + K+V NV+ Sbjct: 88 AVQNLLQYDSTQTFQTGDEIDELIGKSVGSNVL 120 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 7.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 237 NKITFLITFLLRQFDISFKVINAYGVSLGYIFCI 338 N+I L + F+ KV NA+ V+ G+++CI Sbjct: 16 NEIEALKAIFMDDFE-ELKVRNAWNVTNGHVYCI 48 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,663,469 Number of Sequences: 5004 Number of extensions: 55229 Number of successful extensions: 115 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -