Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0284
         (677 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    23   6.7  
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.            23   8.9  

>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 16/36 (44%), Positives = 17/36 (47%)
 Frame = -1

Query: 566  LRKNRGRYLHIPLFNYRISSMLKTV*DLKIM*YQKY 459
            LRKN G       F Y ISSM +T  DL    Y  Y
Sbjct: 924  LRKNMGGLKRFSTFYYLISSM-ETFFDLLDKQYDSY 958


>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
          Length = 1356

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +3

Query: 606  VWAHS*FSINWWYRN 650
            VW HS F +  +YRN
Sbjct: 1058 VWFHSKFGVRLFYRN 1072


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 649,044
Number of Sequences: 2352
Number of extensions: 12522
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)