BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0282 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.4 At4g38560.1 68417.m05459 expressed protein 29 3.2 At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase... 28 7.3 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 252 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 157 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 1 GSYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLXSYSVTWITVVILEL 147 GSY + + + + + GD A+GS Q SYS+ + V+LEL Sbjct: 340 GSYKVRASVSSTLQKILDKHGDIASGSKLQSLRTKSYSLETLAAVVLEL 388 >At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase C (PLC2) identical to phosphoinositide specific phospholipase C(AtPLC2) GI:857374 [Arabidopsis thaliana] Length = 581 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = -2 Query: 366 PLPVTTMVVAETTIES**GRHLKDASPVLDHAICKSYPDSSKLTTSDARPSVDW 205 P V + ++E +E ++ K H + + YP +++T+S+ P V W Sbjct: 339 PDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGW 392 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,197,504 Number of Sequences: 28952 Number of extensions: 296399 Number of successful extensions: 641 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -