BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0279 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_02_0115 - 6758540-6758771,6759417-6759524,6759670-6759840,675... 29 3.1 05_05_0042 - 21798255-21798871,21799400-21799777,21799861-218008... 28 7.1 >05_02_0115 - 6758540-6758771,6759417-6759524,6759670-6759840, 6759967-6760077,6760562-6760663,6761139-6761366, 6761568-6761696,6761753-6761869,6761955-6762301, 6762377-6762931,6763104-6763182,6763429-6763595, 6763857-6764075,6764956-6765139,6765175-6765371, 6765717-6766035,6766379-6766538,6767642-6767794, 6767911-6768013 Length = 1226 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 324 LHKLSLITTFSDLKA*CKNANKNGFVELSNF 416 L++LSL+TTF D+ A K++N + + NF Sbjct: 710 LYQLSLLTTFYDILADEKSSNSKEYTNIVNF 740 >05_05_0042 - 21798255-21798871,21799400-21799777,21799861-21800820, 21800918-21800957,21801471-21801766,21802696-21802774, 21803013-21803100,21803189-21803273,21803364-21803625, 21803720-21805027,21806187-21806393,21807288-21807519, 21808267-21808353,21808427-21808735,21808879-21808957, 21809788-21809867,21809952-21810029,21810744-21810831, 21811102-21811241,21811342-21811415,21812043-21812125, 21812403-21812516,21813975-21814136,21814377-21814641 Length = 2036 Score = 28.3 bits (60), Expect = 7.1 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +3 Query: 447 KNFTENEAEFTIS*I-ACVMNILKRYVIGSET*IFHLKYQDIQKVCCKSVKGSGRGTFLI 623 +N E A+ TI + A + +VI S + +L DI+KV S + G G +I Sbjct: 304 RNSLERRAQPTIEFVFAATEEAIFVHVIISARYMRNLCSDDIEKVLTHSPRSVGEGLPVI 363 Query: 624 ITPKYFWGKLI 656 + P G+L+ Sbjct: 364 VAPSGMLGRLV 374 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,304,107 Number of Sequences: 37544 Number of extensions: 307055 Number of successful extensions: 377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -