BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0279 (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 28 7.2 SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) 28 9.5 SB_16523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 288 CYKICKHYFCYCYINNSKYTC 226 CY C +Y+CYCY Y C Sbjct: 484 CYYYC-YYYCYCYCYYCCYYC 503 >SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) Length = 776 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 84 IRKRFVPFFQLHQNT*NPTML 22 IRKRF+ F+ HQN NPTML Sbjct: 236 IRKRFMAEFKEHQN--NPTML 254 >SB_16523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 83 FENGLCHFSSCTKIRETLRCYES 15 F L H+S+CT RE ++C++S Sbjct: 104 FSKLLKHYSACTVYRELIQCFKS 126 >SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 609 GTFLIITPKYFWGKLILPMAKNKKNV-IASF*YLSWYS 719 G FL+ITP++FW L + N I WYS Sbjct: 27 GLFLLITPRFFWSTYFLFLFGKASNASIMCLAIDRWYS 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,086,466 Number of Sequences: 59808 Number of extensions: 397265 Number of successful extensions: 679 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -