BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0273 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0189 + 19075411-19075497,19075603-19075682,19076707-190768... 28 7.1 11_01_0152 + 1270752-1270947,1271113-1271438,1271571-1272128 27 9.4 02_05_0066 - 25546545-25546999,25547104-25547199,25547294-25547441 27 9.4 >01_05_0189 + 19075411-19075497,19075603-19075682,19076707-19076851, 19077259-19078116,19078664-19078724,19082571-19082680 Length = 446 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 352 NNARPTSQTPSTNNYNNVNIIGT 284 +N RPT + P+ N NVN +GT Sbjct: 185 SNGRPTVEDPTANTDCNVNFMGT 207 >11_01_0152 + 1270752-1270947,1271113-1271438,1271571-1272128 Length = 359 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 358 KINNARPTSQTPSTNNYNNVNIIGTTIIMLF 266 +I N +PTS S+NN NN ++G ++F Sbjct: 108 EIFNLQPTSYGGSSNNKNNKQLVGMKKTLVF 138 >02_05_0066 - 25546545-25546999,25547104-25547199,25547294-25547441 Length = 232 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -3 Query: 232 IYRASFSVNGN*KELLLDNQCYINIGCKVLYAMLYIS 122 ++R FSV+ N ++LL +QCY++ + ML++S Sbjct: 111 VFRQWFSVDKN-EKLLRASQCYLSTTAGPIAGMLFVS 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,305,060 Number of Sequences: 37544 Number of extensions: 217705 Number of successful extensions: 358 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -