BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0273 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 27 9.7 SB_50010| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_36047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 980 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -3 Query: 361 IKINNARPTSQTPSTN-NYNNVNIIGTTIIMLF 266 + IN+ RP+ Q+PS N + N + +GT I+ +F Sbjct: 439 LDINDDRPSFQSPSFNVSVNEIERLGTVILTVF 471 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 79 LSFHHHSISFDKF---LRKYTTLHIKLCSRY*YNIDCLEVTPFSYR 207 L++HHH + F L ++ + H +L + ++ L PF YR Sbjct: 996 LNYHHHHYHYHPFHYRLLRHHSFHYRLLRHHPFHYRVLRHHPFHYR 1041 >SB_50010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 73 SPLSFHHHSISFDKFLRKYTTLHIKLCSRY*YNIDCLEVTPFS 201 S L +H+I F++F + +T H K + ++ D ++ PFS Sbjct: 524 SGLDLSYHAIVFERFRFRRSTRHQKGIVKLFHSRDRFQIVPFS 566 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,282,867 Number of Sequences: 59808 Number of extensions: 289851 Number of successful extensions: 658 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -