BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0270 (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0057 + 21995018-21997006 31 0.84 05_01_0002 - 8097-8246,8384-8495,8572-8735,9367-9519,9603-9732,9... 30 1.9 01_06_0950 - 33265653-33265802,33265905-33265961,33266046-332661... 30 1.9 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 2.6 07_01_0917 + 7735696-7735896,7735907-7736404,7736481-7736813,773... 29 2.6 02_05_0311 + 27782110-27782326,27784121-27784268,27784394-277844... 29 2.6 04_04_1342 + 32775582-32775796,32776589-32776794,32777356-327774... 28 5.9 12_01_0183 - 1350451-1350477,1350887-1350969,1350977-1352696,135... 28 7.8 11_01_0183 - 1440460-1440467,1440832-1440957,1440965-1442858 28 7.8 >05_05_0057 + 21995018-21997006 Length = 662 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +2 Query: 146 DSRPTASQHRSLNRTIAADSPRFLTLRHAPTLPHRAAFKLSLDSPQTSSS 295 D+ ++ + RSL RT + P F P LP AA DSP SS Sbjct: 423 DTSSSSRRRRSLERTSSVRRPSFEVTDAKPVLPAAAAITSVKDSPLIGSS 472 >05_01_0002 - 8097-8246,8384-8495,8572-8735,9367-9519,9603-9732, 9802-9902,10016-10651,10820-10899,11014-11673, 11787-12041,12154-12281,12515-12669,12735-12919, 13020-13049,13164-13239,13371-13504,13703-13994, 14400-14567,14647-14745,14843-15014,15103-15281 Length = 1352 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 112 IPAFSQIKVSRRQSSHSKPASQPQQDH-RSRLTALPDPTACTYTASSRSIQAQSR 273 +PA +S +S S S+P+Q+H R+ + P AC+ T + + ++++ Sbjct: 809 VPAVYAQNISTERSVESSHLSRPEQNHSRANMEVKPGINACSATPAGGEVVSEAK 863 >01_06_0950 - 33265653-33265802,33265905-33265961,33266046-33266111, 33266252-33266317,33266752-33267217,33267313-33267566 Length = 352 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 142 RRQSSHSKPASQPQQDHRSRLTALPDPTACTYTASSRSI 258 ++ S +K A QP+ D RSR L P A TYT +S ++ Sbjct: 302 QKGSESTKDAEQPKPDLRSRGLCLV-PVASTYTVASETV 339 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 251 AAFKLSLDSPQTSSSTGDNHAAFKLSFDSPQTSSSTGTCKLISARTTITKYDTTSSLGGE 430 +A K + + S G + + + SP G +++ R+T + DT++SLG + Sbjct: 559 SAMKFGVAREEKPKSIGRSPVEHEPDYTSPNQDKMHGRLQIMGKRSTTSSVDTSASLGNK 618 >07_01_0917 + 7735696-7735896,7735907-7736404,7736481-7736813, 7736991-7737314,7737367-7737836,7738165-7738447, 7738527-7738640 Length = 740 Score = 29.5 bits (63), Expect = 2.6 Identities = 25/146 (17%), Positives = 64/146 (43%), Gaps = 1/146 (0%) Frame = +1 Query: 133 KVSRRQSSHSKPASQPQQDHRSRLTALPDPTACTYTASSRSIQAQSRLTADFEQHWRQSR 312 K+SR++ S S ++ P Q+H + PDP + ++ + + A + R Sbjct: 104 KISRQRWSRSTSSTPPSQNHLGNTHSSPDPCGMSSMPPNQRKSLRKKSQAYRDLQARNLH 163 Query: 313 SIQAQFRLTANFEQHWHLQANLSTD-NDN*I*HDLQSRRGVMWRVAIIQRKIIDRCLNLA 489 + R A + W + + + N + D+ +R W A +++ L+ Sbjct: 164 PHRLGTRGYAGKQAEWDKEDEAAAESNTPQVLADIPVQRARNWARARVKKNSDG---TLS 220 Query: 490 YDIFKIKRIYTSSEQQHSDRRSTEQI 567 + I + + +Y + +++R++++++ Sbjct: 221 FPIPEDQAVYQKIVELNAERQASQEV 246 >02_05_0311 + 27782110-27782326,27784121-27784268,27784394-27784478, 27784555-27784650,27785666-27785731,27785900-27785998, 27786145-27786258,27786468-27786578,27786672-27786734, 27786816-27786908,27787960-27788073,27788440-27788505, 27788782-27788994,27789086-27789116,27789459-27791587 Length = 1214 Score = 29.5 bits (63), Expect = 2.6 Identities = 28/98 (28%), Positives = 40/98 (40%), Gaps = 1/98 (1%) Frame = +1 Query: 97 TSATTIPAFSQIKVSRRQSSHSKPASQPQQDHRSRLTALPDPTACTYTASSRSIQAQSRL 276 T T P+ SQ + S S P+S P R T P P + A+ R + L Sbjct: 495 TILTYTPSISQFSLQAPMLSLSTPSSPPPPLPPRRATTAPTPVSLLRGAADR---RDAPL 551 Query: 277 TADFEQHWRQSRSIQAQFRLTA-NFEQHWHLQANLSTD 387 T+ +S ++ LTA N H +LQ L +D Sbjct: 552 TSALHAALLKSGALDRTQPLTASNSLLHAYLQCGLLSD 589 >04_04_1342 + 32775582-32775796,32776589-32776794,32777356-32777492, 32778758-32778860,32778961-32779079,32779282-32779346, 32779426-32779642,32779713-32779934 Length = 427 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 202 VGCDGPVEAAMLACCGTTVDDLLLSA 125 V GP AA L CC +TVDD ++SA Sbjct: 38 VALAGPA-AAQLRCCASTVDDGVVSA 62 >12_01_0183 - 1350451-1350477,1350887-1350969,1350977-1352696, 1354258-1354428,1355892-1355939 Length = 682 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 158 WDDCRRLTFICENAGIVVAE 99 WD R TFICE AG V+ E Sbjct: 520 WDPIRAGTFICEYAGEVIDE 539 >11_01_0183 - 1440460-1440467,1440832-1440957,1440965-1442858 Length = 675 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 158 WDDCRRLTFICENAGIVVAE 99 WD R TFICE AG V+ E Sbjct: 505 WDPIRAGTFICEYAGEVIDE 524 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,581,095 Number of Sequences: 37544 Number of extensions: 365424 Number of successful extensions: 1366 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -