BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0267 (760 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0297 - 2314687-2316021 29 3.0 07_03_1557 - 27699675-27699972,27700546-27700630,27700741-277008... 29 4.0 >05_01_0297 - 2314687-2316021 Length = 444 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 323 LVIIANSKGTAKPLFGKNYSGNLCINPKAGT 415 LV+IAN +G A+ Y GN C+ P A T Sbjct: 288 LVVIANLRGVAELNLPGGYYGNACVAPTAIT 318 >07_03_1557 - 27699675-27699972,27700546-27700630,27700741-27700847, 27700942-27701135,27701252-27701368,27701466-27701631, 27701723-27701887,27702185-27703428 Length = 791 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = +2 Query: 347 GTAKPLFGKNYSGNLCINPKAGTGKH------HYPAAWRSGLWMG 463 GT G Y G+ +N K G GK HY WRSGL G Sbjct: 132 GTYTGAAGDTYRGSWSMNLKHGHGKKSYANGDHYDGEWRSGLQDG 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,216,061 Number of Sequences: 37544 Number of extensions: 390097 Number of successful extensions: 635 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -