BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0267 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g43400.1 68416.m04593 phagocytosis and cell motility protein ... 31 0.63 >At3g43400.1 68416.m04593 phagocytosis and cell motility protein ELMO1-related contains weak similarity to ELMO1 [Mus musculus] gi|16118551|gb|AAL14464 Length = 213 Score = 31.5 bits (68), Expect = 0.63 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -1 Query: 376 VFSKQWLGCSLRIGYDHERP*SQYYGPLGFIPYERQRNFLKTYYRFNKIQNGKR 215 + S QW +G+ + P + + G GFI E R F KT+ R K Q GKR Sbjct: 81 LISDQWKN----MGWQRKDPSTDFRGD-GFISLENLRFFAKTFSRLLKKQGGKR 129 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,085,839 Number of Sequences: 28952 Number of extensions: 334373 Number of successful extensions: 562 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -