Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0265
         (713 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    22   5.7  

>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 453 IVFFLLICFSLK 488
           I+FF+L+CF+ K
Sbjct: 954 ILFFMLVCFTCK 965


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 453 IVFFLLICFSLK 488
           I+FF+L+CF+ K
Sbjct: 954 ILFFMLVCFTCK 965


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 453 IVFFLLICFSLK 488
           I+FF+L+CF+ K
Sbjct: 954 ILFFMLVCFTCK 965


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 453 IVFFLLICFSLK 488
           I+FF+L+CF+ K
Sbjct: 954 ILFFMLVCFTCK 965


>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 3/54 (5%)
 Frame = -2

Query: 175 PSVTTLPSA---CLAST*QLETCLVKQFKTCAGCRLQELCLQNCIRTNHNRYQN 23
           P+V  +P A     +S+  LE+       +C G     +   NC+ T    + N
Sbjct: 209 PTVPKIPPAEFPTTSSSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTN 262


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 148,610
Number of Sequences: 336
Number of extensions: 3088
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18947110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)