SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0265
         (713 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan transpo...    27   0.77 
AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan transpo...    27   0.77 
AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein p...    24   4.1  
EF519356-1|ABP68465.1|  500|Anopheles gambiae LRIM1 protein.           23   7.2  
EF519355-1|ABP68464.1|  506|Anopheles gambiae LRIM1 protein.           23   7.2  
DQ974161-1|ABJ52801.1|  409|Anopheles gambiae serpin 2 protein.        23   7.2  
AF203339-1|AAF19834.1|  156|Anopheles gambiae immune-responsive ...    23   7.2  
EF519384-1|ABP68493.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519383-1|ABP68492.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519381-1|ABP68490.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519380-1|ABP68489.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519376-1|ABP68485.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519374-1|ABP68483.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519373-1|ABP68482.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519372-1|ABP68481.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519371-1|ABP68480.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519370-1|ABP68479.1|  452|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519369-1|ABP68478.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519367-1|ABP68476.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519366-1|ABP68475.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519364-1|ABP68473.1|  496|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519363-1|ABP68472.1|  503|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519362-1|ABP68471.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519361-1|ABP68470.1|  497|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519360-1|ABP68469.1|  499|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519359-1|ABP68468.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519358-1|ABP68467.1|  497|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519357-1|ABP68466.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519354-1|ABP68463.1|  506|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519353-1|ABP68462.1|  470|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519352-1|ABP68461.1|  448|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519351-1|ABP68460.1|  486|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519350-1|ABP68459.1|  421|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519349-1|ABP68458.1|  486|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519348-1|ABP68457.1|  503|Anopheles gambiae LRIM1 protein.           23   9.5  
EF519347-1|ABP68456.1|  470|Anopheles gambiae LRIM1 protein.           23   9.5  
AY344814-1|AAR03842.1|  286|Anopheles gambiae LRR Toll protein.        23   9.5  
AY344813-1|AAR03841.1|  286|Anopheles gambiae LRR Toll protein.        23   9.5  
AY344812-1|AAR03840.1|  286|Anopheles gambiae LRR Toll protein.        23   9.5  
AY344811-1|AAR03839.1|  286|Anopheles gambiae LRR Toll protein.        23   9.5  
AY344810-1|AAR03838.1|  286|Anopheles gambiae LRR Toll protein.        23   9.5  
AY344809-1|AAR03837.1|  286|Anopheles gambiae LRR Toll protein.        23   9.5  

>AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 26.6 bits (56), Expect = 0.77
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = -3

Query: 324 VTMCLMHVIFYSTYNTL*TNL-SDRTIYKIFKINFASLCRLSVIG 193
           +T+C  +V+ YS+YN    N+  D TI  I     + L  L V G
Sbjct: 332 LTICFGNVMMYSSYNRFHNNVYRDVTIVSIMDTLTSMLAGLIVFG 376


>AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 26.6 bits (56), Expect = 0.77
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = -3

Query: 324 VTMCLMHVIFYSTYNTL*TNL-SDRTIYKIFKINFASLCRLSVIG 193
           +T+C  +V+ YS+YN    N+  D TI  I     + L  L V G
Sbjct: 332 LTICFGNVMMYSSYNRFHNNVYRDVTIVSIMDTLTSMLAGLIVFG 376


>AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein
           protein.
          Length = 357

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 10/32 (31%), Positives = 15/32 (46%)
 Frame = -2

Query: 106 QFKTCAGCRLQELCLQNCIRTNHNRYQNYMAV 11
           Q +TC  C        NC++   NR+ N + V
Sbjct: 25  QAQTCRNCAAPVHHGLNCVQNRQNRFANVVQV 56


>EF519356-1|ABP68465.1|  500|Anopheles gambiae LRIM1 protein.
          Length = 500

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTMPTLGHYGAYC 317


>EF519355-1|ABP68464.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTMPTLGHYGAYC 317


>DQ974161-1|ABJ52801.1|  409|Anopheles gambiae serpin 2 protein.
          Length = 409

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = -1

Query: 257 IERFIKYSKLISPHYAACLSLASCCKPT 174
           IE   KY ++ + HY A L   S   PT
Sbjct: 130 IEVINKYQQIANTHYHAMLEKVSYSNPT 157


>AF203339-1|AAF19834.1|  156|Anopheles gambiae immune-responsive
           serpin-related proteinISerpF1 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = -1

Query: 257 IERFIKYSKLISPHYAACLSLASCCKPT 174
           IE   KY ++ + HY A L   S   PT
Sbjct: 31  IEVINKYQQIANTHYHAMLEKVSYSNPT 58


>EF519384-1|ABP68493.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519383-1|ABP68492.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519381-1|ABP68490.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519380-1|ABP68489.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519376-1|ABP68485.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519374-1|ABP68483.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519373-1|ABP68482.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519372-1|ABP68481.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519371-1|ABP68480.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519370-1|ABP68479.1|  452|Anopheles gambiae LRIM1 protein.
          Length = 452

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 290 CTVPTLGHYGAYC 302


>EF519369-1|ABP68478.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519367-1|ABP68476.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519366-1|ABP68475.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519364-1|ABP68473.1|  496|Anopheles gambiae LRIM1 protein.
          Length = 496

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519363-1|ABP68472.1|  503|Anopheles gambiae LRIM1 protein.
          Length = 503

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519362-1|ABP68471.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519361-1|ABP68470.1|  497|Anopheles gambiae LRIM1 protein.
          Length = 497

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519360-1|ABP68469.1|  499|Anopheles gambiae LRIM1 protein.
          Length = 499

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519359-1|ABP68468.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519358-1|ABP68467.1|  497|Anopheles gambiae LRIM1 protein.
          Length = 497

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519357-1|ABP68466.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519354-1|ABP68463.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519353-1|ABP68462.1|  470|Anopheles gambiae LRIM1 protein.
          Length = 470

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519352-1|ABP68461.1|  448|Anopheles gambiae LRIM1 protein.
          Length = 448

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519351-1|ABP68460.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519350-1|ABP68459.1|  421|Anopheles gambiae LRIM1 protein.
          Length = 421

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519349-1|ABP68458.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519348-1|ABP68457.1|  503|Anopheles gambiae LRIM1 protein.
          Length = 503

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>EF519347-1|ABP68456.1|  470|Anopheles gambiae LRIM1 protein.
          Length = 470

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 305 CTVPTLGHYGAYC 317


>AY344814-1|AAR03842.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 230 CTVPTLGHYGAYC 242


>AY344813-1|AAR03841.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 230 CTVPTLGHYGAYC 242


>AY344812-1|AAR03840.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 230 CTVPTLGHYGAYC 242


>AY344811-1|AAR03839.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 230 CTVPTLGHYGAYC 242


>AY344810-1|AAR03838.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 230 CTVPTLGHYGAYC 242


>AY344809-1|AAR03837.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 188 CCKPTFGHYSTVC 150
           C  PT GHY   C
Sbjct: 230 CTVPTLGHYGAYC 242


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 638,893
Number of Sequences: 2352
Number of extensions: 11916
Number of successful extensions: 56
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 73177125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -