BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0257 (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) 348 2e-96 SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) 29 2.6 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 2.6 SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) 29 2.6 SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 28 4.6 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_55109| Best HMM Match : fn3 (HMM E-Value=0.017) 27 8.0 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) 27 8.0 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) 27 8.0 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 27 8.0 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) 27 8.0 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 27 8.0 SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) 27 8.0 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 27 8.0 SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) 27 8.0 SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) 27 8.0 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 27 8.0 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 27 8.0 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 27 8.0 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 8.0 SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) Length = 240 Score = 348 bits (855), Expect = 2e-96 Identities = 168/187 (89%), Positives = 177/187 (94%) Frame = +2 Query: 2 KKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRI 181 KKRKFV DG+FKAELNEFLTRELAEDGYSGVEVRVTPIR+EIII+ATRTQ+VLGEKGRRI Sbjct: 7 KKRKFVADGLFKAELNEFLTRELAEDGYSGVEVRVTPIRTEIIILATRTQNVLGEKGRRI 66 Query: 182 RELTSVVQKRFNIPEQSVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFI 361 RELTSVVQKRF PE SVELYAEKVATRGLCAIAQ ESLRYKLIGGLAVRRACYGVLRFI Sbjct: 67 RELTSVVQKRFGFPEGSVELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLRFI 126 Query: 362 MESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVNTATRHVLLRQGVLGIKV 541 MESGA+GCEVVVSGKLRGQRAKSMKFVDGLM+H+G+P YV+TA RHV LRQGVLGIKV Sbjct: 127 MESGAKGCEVVVSGKLRGQRAKSMKFVDGLMVHAGEPTTHYVDTAVRHVYLRQGVLGIKV 186 Query: 542 KIMLPWD 562 KIMLPWD Sbjct: 187 KIMLPWD 193 >SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) Length = 383 Score = 29.1 bits (62), Expect = 2.6 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 6/72 (8%) Frame = +2 Query: 50 EFLTRELAEDGYSGVEVR--VTPIR----SEIIIMATRTQSVLGEKGRRIRELTSVVQKR 211 E+L R++ D YS E +TP +IMA R QSVL ++GR +LT Q+R Sbjct: 175 EYLQRKI-NDAYSPEEAEKNITPYSLCSYENPMIMAFRLQSVLRKRGR--DDLT-WAQQR 230 Query: 212 FNIPEQSVELYA 247 F+ SVE +A Sbjct: 231 FDDLADSVEQFA 242 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +3 Query: 33 SRQNSMSSSLGSWPRTATPAWKCGSLPSARRSLLWPPGH-RVCSERKDAESVSSLP*Y 203 +R+ ++ +L + P T +CG + +AR L+ P H R + V SLP Y Sbjct: 272 TRKMMLTRALSTTPSTTPELRRCGGVLTAREGLIMSPNHPRPYPSDTHCKWVISLPSY 329 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = +2 Query: 80 GYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFNIPEQSVELYAEKVA 259 GY+ + + S +++ A +++ ++ + +RE +QKRF E+ +Y Sbjct: 1941 GYTARKEYSRCVTSIVLMQALVRRNLAVKRYQALREAAIGIQKRFRAKEEGKLVYLMFHI 2000 Query: 260 TRGLCAIAQA 289 RG C + Q+ Sbjct: 2001 QRGACIVIQS 2010 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 29.1 bits (62), Expect = 2.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 400 WQAAWSTCQINEVCRWTHDPLW 465 W+ AW+ C + E +T++P W Sbjct: 76 WKQAWTPCSLQETTIYTNNPPW 97 >SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) Length = 976 Score = 29.1 bits (62), Expect = 2.6 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 394 CIWQAAWSTCQINEVCRWTHDPLWRP 471 C W + W + E WTH P RP Sbjct: 185 CRWLSQWKQSEEEESVLWTHSPARRP 210 >SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +1 Query: 259 YSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPFHHGIWCPW 381 Y+W L + P + ++ Y R + L C+P + W W Sbjct: 4 YNWWLAWNPALLCLMRQYNRWLAWNPALLCNPRQYNRWLAW 44 >SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) Length = 933 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 196 RSTEAIQHSRAICRIVC*KGGYSWPLRYRPGRISKIQAYR 315 RS +Q + + C V GY PLR +P R S + A+R Sbjct: 464 RSRNPVQRNESYCNAVSRSPGYYSPLRDKPARSSPL-AFR 502 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55109| Best HMM Match : fn3 (HMM E-Value=0.017) Length = 339 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 413 GQRAKSMKFVDGLMIHSGDPCNDYVNTATRHVLLRQGVLGIKVKI 547 G++ ++ IH G P DY + L R+GV G+ V I Sbjct: 25 GKKTAGRLRLERTQIHGGSPVIDYKVEVDQVKLAREGVTGVPVVI 69 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) Length = 157 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 158 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 192 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 226 LWNVESLLYYGSELTDSASFLSEHTLCPGGHNNDLRADGSDPH 98 LWN++ + + F + H+ C GG N D A GS+ H Sbjct: 186 LWNIKDRVLERKYQGVTQGFYTIHS-CFGGVNQDFLASGSEDH 227 >SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) Length = 110 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 194 SVVQKRFNIPEQSVELYAEKVATRGLCAI 280 +++ + F P E +A K+ TRGLC I Sbjct: 402 NILHRHFGYPVTFQEFFAIKLITRGLCRI 430 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 103 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 137 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 29 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 63 >SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) Length = 120 Score = 27.5 bits (58), Expect = 8.0 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +2 Query: 41 ELNEFLTRELAE-DGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFN 217 E+ E + + +AE +G SG EV+ ++ + ++ +TQ E ++ +EL + +KR N Sbjct: 20 EVIEVVNKLIAEGEGESGNEVKENKVKKKPSVIK-QTQ----EDEKKTKELEELKEKRIN 74 Query: 218 IPE 226 +P+ Sbjct: 75 LPQ 77 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 68 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) Length = 117 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) Length = 97 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) Length = 97 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 253 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 357 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,697,027 Number of Sequences: 59808 Number of extensions: 403451 Number of successful extensions: 1152 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1145 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -