BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0257 (564 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.70 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.70 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 6.5 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 8.6 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.70 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -3 Query: 460 VDHESIYKLH*FGTLTTQLARYNNFTTTGTRFHDETENTIASTTYSETSD 311 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1162 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1211 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.70 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -3 Query: 460 VDHESIYKLH*FGTLTTQLARYNNFTTTGTRFHDETENTIASTTYSETSD 311 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1158 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1207 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 2.1 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 127 DLRADGSDPHFH 92 ++ DGS PHFH Sbjct: 621 EISQDGSSPHFH 632 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 142 QDTECARRERTQ 177 QD +C R+ERTQ Sbjct: 1646 QDHDCIRQERTQ 1657 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 115 PLGDHYYGHQDTECARRERT 174 PL +H Y D++ + ERT Sbjct: 1329 PLSEHIYSSIDSDYSTLERT 1348 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.0 bits (42), Expect = 8.6 Identities = 6/20 (30%), Positives = 15/20 (75%) Frame = -1 Query: 195 EVSSRILRPFSPSTLCVLVA 136 ++ +++ F+PSTL V+++ Sbjct: 198 QIGHHLIQTFAPSTLVVMLS 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,848 Number of Sequences: 438 Number of extensions: 3324 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -