SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0256
         (749 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       27   0.25 
AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.            26   0.33 
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    22   7.1  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    22   7.1  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    22   7.1  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    22   7.1  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    22   7.1  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    21   9.3  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    21   9.3  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 26.6 bits (56), Expect = 0.25
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = +1

Query: 52  DDGSTVVEKKGRGRPKANGTQPESKELKKRGRPPAATRTKDSAKSSDDE 198
           +D  T +E+ GRG+ + +G          RGR     + KD   ++D E
Sbjct: 69  NDKKTDIEETGRGKGRGHGKGGSRGRGGNRGRTGFNNKNKDGDDNNDYE 117


>AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.
          Length = 493

 Score = 26.2 bits (55), Expect = 0.33
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -1

Query: 221 PRLATGACSSSEDLAESFVLVAAGGRPRFLSSFD 120
           P++ T   S    +A +F+L    G PR +SSFD
Sbjct: 315 PQILTYKYSKRYKMAVAFMLSHPFGTPRIMSSFD 348


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 88  LSNNYNYNNNY 98


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 321 LSNNYNYNNNY 331


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 704 LSSTYNFKNNY 736
           LS+ YN+ NNY
Sbjct: 321 LSNNYNYNNNY 331


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 21.4 bits (43), Expect = 9.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 153 WRPTSFFK 130
           WRP SFFK
Sbjct: 119 WRPDSFFK 126


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 21.4 bits (43), Expect = 9.3
 Identities = 10/26 (38%), Positives = 12/26 (46%)
 Frame = -3

Query: 507 LTKYFNFETINEKQKFIFTVHILNYH 430
           L  YFN          + T+ ILNYH
Sbjct: 294 LGTYFNCIMFMVASSVVSTILILNYH 319


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,322
Number of Sequences: 438
Number of extensions: 3877
Number of successful extensions: 24
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23510295
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -