BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0255 (795 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 28 7.6 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -2 Query: 776 SFSCSCRCQYQNQLFKTFSSNLDICFRNPMPENLDPRMTAPT*GCTL 636 ++ CSC+ Y+ K N+D C NP R T P C + Sbjct: 377 TYGCSCKAGYRG---KNCQENIDECDPNPCLNGATSRCTRPAIVCAI 420 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 686 PENLDPRMTAPT*GCTLKNYIYFLN*YERIVF*LLHYK 573 P N+DP + +PT L +++YF Y+ + LHYK Sbjct: 186 PHNIDPTLPSPTLLNALLHFLYF---YQAPHYQALHYK 220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,428,071 Number of Sequences: 59808 Number of extensions: 535825 Number of successful extensions: 1303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1303 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -